Potri.004G078300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17880 196 / 4e-65 ATBTF3 basic transcription factor 3 (.1)
AT1G73230 196 / 6e-65 Nascent polypeptide-associated complex NAC (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G141100 224 / 1e-76 AT1G73230 196 / 3e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.015G029800 185 / 9e-61 AT1G17880 232 / 4e-79 basic transcription factor 3 (.1)
Potri.012G037900 183 / 4e-60 AT1G73230 225 / 1e-76 Nascent polypeptide-associated complex NAC (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031551 213 / 7e-72 AT1G17880 255 / 2e-88 basic transcription factor 3 (.1)
Lus10015123 211 / 4e-71 AT1G17880 253 / 1e-87 basic transcription factor 3 (.1)
Lus10039661 210 / 1e-70 AT1G17880 253 / 2e-87 basic transcription factor 3 (.1)
Lus10027180 194 / 1e-64 AT1G17880 238 / 1e-81 basic transcription factor 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Potri.004G078300.2 pacid=42794618 polypeptide=Potri.004G078300.2.p locus=Potri.004G078300 ID=Potri.004G078300.2.v4.1 annot-version=v4.1
ATGAATAGAGAGAAGCTCATGAAGATGGCTGGTTCTGTTCGAACTGGTGGCAAGGGAACCATGAGAAGAAAGAAGAAGGCAGTGCACAAGTCATCAACAA
CTGATGACAAGAAGTTGCAAAGCACCTTGAAGAGAATTGGGGTTAATGCAATTCCAGCTATTGAAGAAGTGAACATCTTTAAGGATGATTTGGTTATTCA
GTTTGTTAACCCTAAAGTCCAAGCCTCTATTGTTGCCAACACATGGGTTATTACAGGCACTCCTCAAACCAGAAAACTACAAGATATTCTTCCAGGGATT
ATCAACCAACTTGGGCCAGATAACTTGGACAACCTTAGGAAGTTGGCGGAGCAGTTTCAAAAGGAGGTGCCATCTGGTGATGCAGGAGCAGCACAAGAAG
ATGACGATGATGTCCCAGAGCTTGTGGGCGGTGAGACTTTTGAAGCTGCTGCAGAAGAGGGACAGAAGTAA
AA sequence
>Potri.004G078300.2 pacid=42794618 polypeptide=Potri.004G078300.2.p locus=Potri.004G078300 ID=Potri.004G078300.2.v4.1 annot-version=v4.1
MNREKLMKMAGSVRTGGKGTMRRKKKAVHKSSTTDDKKLQSTLKRIGVNAIPAIEEVNIFKDDLVIQFVNPKVQASIVANTWVITGTPQTRKLQDILPGI
INQLGPDNLDNLRKLAEQFQKEVPSGDAGAAQEDDDDVPELVGGETFEAAAEEGQK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73230 Nascent polypeptide-associated... Potri.004G078300 0 1
AT5G09500 Ribosomal protein S19 family p... Potri.002G043200 7.34 0.9174
AT1G73230 Nascent polypeptide-associated... Potri.017G141100 11.22 0.9094
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Potri.013G027600 11.83 0.8941 ATBBC1.1
AT4G25740 RNA binding Plectin/S10 domain... Potri.017G146700 12.00 0.9139 RPS10.3
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.010G060400 13.03 0.8849
AT5G04800 Ribosomal S17 family protein (... Potri.008G017300 17.32 0.9019
AT1G77750 Ribosomal protein S13/S18 fami... Potri.002G088400 18.16 0.8722
AT4G10450 Ribosomal protein L6 family (.... Potri.011G147700 20.24 0.9015 Pt-RPL9.4
AT5G61170 Ribosomal protein S19e family ... Potri.004G118800 20.92 0.8951 RPS19.1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.011G148700 22.64 0.8918 RPL9.5

Potri.004G078300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.