Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52545 79 / 2e-19 unknown protein AT5G03580 47 / 5e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G16380 49 / 7e-07 PAB6 poly(A) binding protein 6 (.1) AT1G71770 45 / 2e-05 PAB5 poly(A)-binding protein 5 (.1), poly(A)-binding protein 5 (.2) AT1G49760 44 / 2e-05 PABP8, PAB8 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) AT2G36660 44 / 3e-05 PAB7 poly(A) binding protein 7 (.1) AT1G60650 44 / 3e-05 AtRZ-1b AtRZ-1b, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT2G24590 42 / 0.0001 RSZ22a, At-RSZ22a RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT4G31580 41 / 0.0002 SRZ22, RSZP22, SRZ-22, RSZ22, At-RSZ22 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) AT5G09880 41 / 0.0003 Splicing factor, CC1-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G228700 [exp] 44 / 3e-05 AT5G04280 172 / 7e-52 AtRZ-1c, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1) Potri.018G009100 [exp] 43 / 5e-05 AT4G31580 174 / 2e-55 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Potri.009G137200 [exp] 43 / 5e-05 AT2G16940 535 / 0.0 Splicing factor, CC1-like (.1.2.3) Potri.006G272400 [exp] 42 / 6e-05 AT2G24590 152 / 4e-47 RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.007G028300 [exp] 42 / 8e-05 AT2G18510 453 / 4e-160 embryo defective 2444, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G304000 [exp] 42 / 0.0001 AT4G34110 837 / 0.0 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) Potri.008G172100 [exp] 42 / 0.0001 AT1G60000 288 / 5e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.008G033000 [exp] 42 / 0.0001 AT1G60650 172 / 3e-52 AtRZ-1b, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) Potri.019G050600 [exp] 41 / 0.0001 AT1G23860 131 / 3e-39 RS-containing zinc finger protein 21 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014958 [exp] 212 / 2e-70 AT5G52545 55 / 2e-10 unknown protein Lus10038840 [exp] 197 / 8e-65 AT3G16380 62 / 2e-11 poly(A) binding protein 6 (.1) Lus10026925 [exp] 44 / 2e-05 AT4G31580 184 / 2e-59 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10020123 [exp] 44 / 2e-05 AT4G31580 188 / 2e-61 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10002835 [exp] 44 / 5e-05 AT4G34110 918 / 0.0 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) Lus10027886 [exp] 43 / 7e-05 AT4G34110 922 / 0.0 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) Lus10012994 [exp] 42 / 0.0001 AT4G31580 162 / 3e-50 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030858 [exp] 42 / 0.0001 AT4G31580 166 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10002093 [exp] 42 / 0.0002 AT5G09880 600 / 0.0 Splicing factor, CC1-like (.1) Lus10000826 [exp] 42 / 0.0002 AT5G09880 589 / 0.0 Splicing factor, CC1-like (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.004G079400.2 pacid=42795318 polypeptide=Potri.004G079400.2.p locus=Potri.004G079400 ID=Potri.004G079400.2.v4.1 annot-version=v4.1 ATGCAGGATCCTAATTTTTTAATTGATGAGAAGGCTGAAAGTAGAGTTTATATCGGTAACCTTGACTTGAGAATAACAGAGGCTGCTCTGATTAAGATGT TTACTCCCTATGGCAAGATTTTATCTGAAGAATTTCTATGGCATACTCGTGGACCAAAACGTGGAGAGCCAAGGGGCTTTGCTTTTATCCAGTTTAGCAC TAAAGAGGTAAGCTGTATGCTTCTTTTGCTTTTGTACCAAGGCAAACTCCTGATTTCCACGTTTAAAGTGAGTATGCAGGAAGCTAAACTGGCCAAGGAG AAGATGCATGGGAGGTTAGCTTGTGGCCGCCCTTTGGTTGTTCGTCTTGCCAGCGAGAAATACGTGGATGAAGCAGCACAGGATTCTTCCACAGCACTTG GTGAGGCAAAGAAAGCTGGCCTTACTGGTAGCACTTTAGGGCAGACAAGTCGTAGTGCCAAGATAGCTGCAATAAAGAACAAATTGAGAGCCTTGGAAGA AGGGGGCCCTAGTGTGAAGAAGCAGAAGCAAGCTGACAGTGACTCTTGTAAGGATAGTCTTGACCACTCACAAGACAAGGGATAG
AA sequence Show only first row Show all	>Potri.004G079400.2 pacid=42795318 polypeptide=Potri.004G079400.2.p locus=Potri.004G079400 ID=Potri.004G079400.2.v4.1 annot-version=v4.1 MQDPNFLIDEKAESRVYIGNLDLRITEAALIKMFTPYGKILSEEFLWHTRGPKRGEPRGFAFIQFSTKEVSCMLLLLLYQGKLLISTFKVSMQEAKLAKE KMHGRLACGRPLVVRLASEKYVDEAAQDSSTALGEAKKAGLTGSTLGQTSRSAKIAAIKNKLRALEEGGPSVKKQKQADSDSCKDSLDHSQDKG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G52545			unknown protein		Potri.004G079400 [exp]	0	1
AT3G49000			RNA polymerase III subunit RPC...		Potri.015G144900 [exp]	2.00	0.8797
AT3G44370			Membrane insertion protein, Ox...		Potri.009G121800 [exp]	3.31	0.8380
AT5G55760		SRT1	sirtuin 1 (.1)		Potri.001G368100 [exp]	3.60	0.8366
AT1G48140		DPMS3	dolichol phosphate mannose syn...		Potri.002G245800 [exp]	5.47	0.8681
AT1G66590		ATCOX19-1	A. THALIANA CYTOCHROME C OXIDA...		Potri.001G187200 [exp]	6.00	0.8552
					Potri.001G247000 [exp]	9.79	0.8644
AT3G18520		HDA15, ATHDA15	histone deacetylase 15 (.1.2)		Potri.012G060400 [exp]	11.18	0.8131
AT1G14130			2-oxoglutarate (2OG) and Fe(II...		Potri.011G146600 [exp]	12.12	0.7776	ARRO.1
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Potri.001G372500 [exp]	12.72	0.8280
AT1G02960			unknown protein		Potri.002G208058 [exp]	13.78	0.8207

Compare expression of checked genes

Potri.004G079400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.