Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25680 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1) AT4G25660 335 / 9e-117 PPPDE putative thiol peptidase family protein (.1) AT2G25190 96 / 1e-23 PPPDE putative thiol peptidase family protein (.1) AT5G47310 90 / 3e-21 PPPDE putative thiol peptidase family protein (.1) AT5G25170 89 / 5e-21 PPPDE putative thiol peptidase family protein (.1) AT1G80690 89 / 7e-21 PPPDE putative thiol peptidase family protein (.1) AT4G17486 88 / 1e-20 PPPDE putative thiol peptidase family protein (.1.2) AT1G47740 86 / 2e-19 PPPDE putative thiol peptidase family protein (.1.2) AT4G31980 85 / 2e-18 unknown protein AT3G07090 48 / 2e-06 PPPDE putative thiol peptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G143132 [exp] 442 / 8e-159 AT4G25680 331 / 2e-115 PPPDE putative thiol peptidase family protein (.1) Potri.018G021700 [exp] 97 / 5e-24 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1) Potri.006G261500 [exp] 96 / 9e-24 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1) Potri.003G080300 [exp] 96 / 1e-23 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1) Potri.001G154400 [exp] 92 / 3e-22 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1) Potri.001G047800 [exp] 91 / 8e-22 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1) Potri.003G180400 [exp] 90 / 2e-21 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1) Potri.T126004 [exp] 85 / 2e-19 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.009G113168 [exp] 85 / 2e-19 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027510 [exp] 377 / 4e-133 AT4G25680 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1) Lus10039275 [exp] 374 / 7e-132 AT4G25680 348 / 6e-122 PPPDE putative thiol peptidase family protein (.1) Lus10038841 [exp] 368 / 5e-130 AT4G25680 343 / 2e-120 PPPDE putative thiol peptidase family protein (.1) Lus10014960 [exp] 366 / 4e-129 AT4G25680 341 / 1e-119 PPPDE putative thiol peptidase family protein (.1) Lus10018326 [exp] 99 / 6e-25 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1) Lus10017127 [exp] 98 / 1e-24 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1) Lus10007844 [exp] 95 / 2e-23 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2) Lus10004755 [exp] 95 / 3e-23 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2) Lus10005341 [exp] 93 / 1e-22 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1) Lus10040170 [exp] 93 / 2e-22 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF05903 [poplar] [flax] Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence Show only first row Show all	>Potri.004G079800.1 pacid=42794081 polypeptide=Potri.004G079800.1.p locus=Potri.004G079800 ID=Potri.004G079800.1.v4.1 annot-version=v4.1 ATGACGGAGGTGATATTGCATGTGTATGATGTGACTAATAGTGGATCGGAGAAGACGAACAACACAATTTTGAACATCAACAAGATCTTCAAAGACGCTA TTGGTCTCGGTGGCATCTTCCACAGCGCCGTTCAGATACATGGAGATGATGAATGGTCTTTTGGGTTTTGTGAGCAAGGAACTGGAGTTTTTAGTTGCCC CTCTAGTAAGAATCCGATGTATACATATCGTGAGAAAATTGTACTAGGAAAAACTAGTTGTTCAATCTTTAAGGTGAATCAGATCTTGCGGGAACTTAGT AGAGAATGGCCTGGAGATGCCTATGACTTGTTGGCCAAGAACTGTAATCACTTCTGTGATGAATTTTGCGAAAGGCTTGGTGTGCCAAAACTTCCAGGTT GGGTCAATCGTTTTGCCAATGCTGGCGATGCTGCTATGGAAGTAGCAGGAAATACAGCCTTCCGGTTTAGACAAGCCAAGACTGAGATAGTATCTGCCAG CAAAGTTGCTTATCGTTTCCTTGTGGGTGTTACTTCCAATAACGGGTCTGGTCTTGAGTCCCCTGAAAACTCAAACAGAGGTGTCCCAAGATTTCAAGGA ACCTGGTTTAAAAATCTCATAGCAAACGGTGCCAAACCATCCAGTAGCACAGAAGTTGATAATCAGGACGAAAACATGCTTCTTCAGCAACAACGCATCA AGCAAGGGGCCGATCAACTATCTCGGCAGAACTCACAACAAGAATCAGATCCACTGCATCAGAATTCAAGGCATGATGAAGCATTACCAGCATCTAGCCC ATATTAG
AA sequence Show only first row Show all	>Potri.004G079800.1 pacid=42794081 polypeptide=Potri.004G079800.1.p locus=Potri.004G079800 ID=Potri.004G079800.1.v4.1 annot-version=v4.1 MTEVILHVYDVTNSGSEKTNNTILNINKIFKDAIGLGGIFHSAVQIHGDDEWSFGFCEQGTGVFSCPSSKNPMYTYREKIVLGKTSCSIFKVNQILRELS REWPGDAYDLLAKNCNHFCDEFCERLGVPKLPGWVNRFANAGDAAMEVAGNTAFRFRQAKTEIVSASKVAYRFLVGVTSNNGSGLESPENSNRGVPRFQG TWFKNLIANGAKPSSSTEVDNQDENMLLQQQRIKQGADQLSRQNSQQESDPLHQNSRHDEALPASSPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25680			PPPDE putative thiol peptidase...		Potri.004G079800 [exp]	0	1
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Potri.012G075600 [exp]	6.78	0.8935	Pt-ALDH10.1
AT4G28088			Low temperature and salt respo...		Potri.006G182500 [exp]	12.40	0.8891
AT5G42330			unknown protein		Potri.002G010400 [exp]	14.28	0.8634
AT5G20885			RING/U-box superfamily protein...		Potri.006G217000 [exp]	17.43	0.8622
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Potri.010G215500 [exp]	19.74	0.8436
AT1G48880		TBL7	TRICHOME BIREFRINGENCE-LIKE 7 ...		Potri.002G071900 [exp]	21.35	0.8739
AT1G12500			Nucleotide-sugar transporter f...		Potri.001G114100 [exp]	26.90	0.8707
					Potri.013G156300 [exp]	27.03	0.8544
AT4G15960			alpha/beta-Hydrolases superfam...		Potri.010G010800 [exp]	30.93	0.8588
AT3G23610		DSPTP1	dual specificity protein phosp...		Potri.010G033000 [exp]	37.08	0.8637

Compare expression of checked genes

Potri.004G079800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.