Potri.004G081466 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17230 260 / 1e-86 PSY PHYTOENE SYNTHASE (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G138900 273 / 2e-91 AT5G17230 630 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
Potri.002G056800 256 / 3e-85 AT5G17230 555 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
Potri.005G205800 254 / 1e-84 AT5G17230 549 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
Potri.001G007700 228 / 2e-74 AT5G17230 443 / 4e-155 PHYTOENE SYNTHASE (.1.2.3)
Potri.003G217950 218 / 2e-70 AT5G17230 443 / 5e-155 PHYTOENE SYNTHASE (.1.2.3)
Potri.003G218000 213 / 1e-68 AT5G17230 411 / 2e-142 PHYTOENE SYNTHASE (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020729 254 / 6e-85 AT5G17230 491 / 7e-174 PHYTOENE SYNTHASE (.1.2.3)
Lus10029809 254 / 1e-83 AT5G17230 491 / 3e-172 PHYTOENE SYNTHASE (.1.2.3)
Lus10001416 247 / 1e-81 AT5G17230 545 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
Lus10001050 241 / 2e-79 AT5G17230 535 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
Lus10039186 219 / 5e-71 AT5G17230 442 / 1e-154 PHYTOENE SYNTHASE (.1.2.3)
Lus10013753 219 / 6e-71 AT5G17230 446 / 4e-156 PHYTOENE SYNTHASE (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00494 SQS_PSY Squalene/phytoene synthase
Representative CDS sequence
>Potri.004G081466.2 pacid=42795249 polypeptide=Potri.004G081466.2.p locus=Potri.004G081466 ID=Potri.004G081466.2.v4.1 annot-version=v4.1
ATGATATCGGAAGGTTCTATGGATGTAAGAGACGATGACTCTCAAGACAGAAAATCAGCCTTTTGCTTCTTTCTTACAATGTTTTCTGCACATGTAGTGT
GGTGTAGGAGGACCGACGAGCTGGTTGATGGGCCTAATGCTTCACGCATTGCACCGACAGCTTTAGATAGGTGGGAGGCAAGGTTGGAAGATCTTTTCCA
AGGACGTCCATTCGATATGATGGATGCTGCTCTAGCAGACACGGTGGCTAAATTTCCTGTTGACATTCAGCCATTCAAAGATATGATTGAAGGAATGAGG
ATGGATCTGACGAAATCAAGATACAAAAACTTCGATGAGCTCTATCTTTACTGTTATTATGTTGCAGGGACTGTTGGACTATTGAGTGTTCCAGTAATGG
GTATTGCACCTGAATCTCAGGCACCAACCGAGAGTGTTTATAATGCTGCCTTGGCATTAGGGATAGCTAATCAGCTCACCAACATACTCAGGGATGTCGG
AGAAGAGTAA
AA sequence
>Potri.004G081466.2 pacid=42795249 polypeptide=Potri.004G081466.2.p locus=Potri.004G081466 ID=Potri.004G081466.2.v4.1 annot-version=v4.1
MISEGSMDVRDDDSQDRKSAFCFFLTMFSAHVVWCRRTDELVDGPNASRIAPTALDRWEARLEDLFQGRPFDMMDAALADTVAKFPVDIQPFKDMIEGMR
MDLTKSRYKNFDELYLYCYYVAGTVGLLSVPVMGIAPESQAPTESVYNAALALGIANQLTNILRDVGEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Potri.004G081466 0 1
AT1G79750 ATNADP-ME4 Arabidopsis thaliana NADP-mali... Potri.018G086700 3.31 0.8346
AT2G20770 GCL2 GCR2-like 2 (.1) Potri.013G134700 8.94 0.8589
AT5G57770 Plant protein of unknown funct... Potri.018G099000 9.79 0.8248
AT1G67265 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 ... Potri.004G102950 12.64 0.7909
AT4G02550 unknown protein Potri.010G215600 19.44 0.8628
AT2G03670 CDC48B cell division cycle 48B (.1) Potri.001G128700 23.02 0.8050 Pt-CDC48.1
AT1G60800 NIK3 NSP-interacting kinase 3 (.1) Potri.008G188800 23.36 0.8311
AT4G02550 unknown protein Potri.006G196716 27.71 0.8428
AT5G09380 RNA polymerase III RPC4 (.1) Potri.005G126700 29.15 0.8274
AT4G25420 AT2301, GA5, AT... GA REQUIRING 5, ARABIDOPSIS TH... Potri.002G151300 29.93 0.8186 GA20ox2-1

Potri.004G081466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.