Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-MALD3.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38540 122 / 3e-37 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 115 / 2e-34 LTP3 lipid transfer protein 3 (.1) AT3G51600 110 / 2e-32 LTP5 lipid transfer protein 5 (.1) AT5G59310 108 / 1e-31 LTP4 lipid transfer protein 4 (.1) AT3G51590 104 / 3e-30 LTP12 lipid transfer protein 12 (.1) AT2G38530 103 / 1e-29 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G01870 103 / 1e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 97 / 4e-27 LTP6 lipid transfer protein 6 (.1.2) AT4G33355 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G15050 86 / 7e-23 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 206 / 4e-70 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.006G108100 [exp] 128 / 2e-39 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 122 / 3e-37 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 120 / 2e-36 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 120 / 2e-36 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G135500 [exp] 103 / 7e-30 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232700 [exp] 89 / 8e-24 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 89 / 9e-24 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 80 / 1e-20 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015279 [exp] 125 / 4e-38 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025234 [exp] 114 / 5e-34 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10026418 [exp] 113 / 2e-33 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025151 [exp] 112 / 4e-33 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10014167 [exp] 110 / 2e-32 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10015278 [exp] 108 / 6e-32 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10022745 [exp] 107 / 4e-31 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025230 [exp] 108 / 5e-31 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10025148 [exp] 106 / 1e-30 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025231 [exp] 102 / 4e-29 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF00234 [poplar] [flax] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Potri.004G086600.1 pacid=42796188 polypeptide=Potri.004G086600.1.p locus=Potri.004G086600 ID=Potri.004G086600.1.v4.1 annot-version=v4.1 ATGGCTTCTTCAATGAGCTTGAAGCTGGCCTGTGCCATGCTTGTAGCGATGGTTGTTAGTGCACCACTAGCAGAAGCTGCCATCTCATGTGGCCAGGTGT CAAGCAGCTTGGCACAATGTATAACCTACCTCCAGAAGGGTGGGGCTGTGCCTGCAGCTTGCTGCAGTGGGTTGAAAGGACTTAATTCTGCAGCCACGAC CACCGCCGACCGCCAAGGGGTCTGCAACTGTTTGAAATCCTTGGCTGGTAAGATCTCTGGCATCAACTATGGCGTGGCTGCTGGCCTCCCTTCAAAGTGT GGTGTATCCATCTCCTACAAAATCAGTCCTTCCACAGATTGCAAAAGCGTGAAGTGA
AA sequence Show only first row Show all	>Potri.004G086600.1 pacid=42796188 polypeptide=Potri.004G086600.1.p locus=Potri.004G086600 ID=Potri.004G086600.1.v4.1 annot-version=v4.1 MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKC GVSISYKISPSTDCKSVK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Potri.004G086600 [exp]	0	1	Pt-MALD3.1
AT5G17540			HXXXD-type acyl-transferase fa...		Potri.003G019900 [exp]	1.00	0.9925
AT5G01870			Bifunctional inhibitor/lipid-t...		Potri.016G135800 [exp]	2.64	0.9793
AT5G20900	ZIM	TIFY3B, JAZ12	jasmonate-zim-domain protein 1...		Potri.018G047100 [exp]	5.47	0.9638
AT2G16630			Pollen Ole e 1 allergen and ex...		Potri.004G169200 [exp]	5.83	0.9720
AT5G65940		CHY1	beta-hydroxyisobutyryl-CoA hyd...		Potri.018G004200 [exp]	7.74	0.9798
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Potri.010G032800 [exp]	8.12	0.9836
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Potri.004G086500 [exp]	9.79	0.9589
					Potri.004G088400 [exp]	10.34	0.9351
AT1G65450			HXXXD-type acyl-transferase fa...		Potri.010G180000 [exp]	13.41	0.9810
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Potri.003G172400 [exp]	16.79	0.9793

Compare expression of checked genes

Potri.004G086600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.