Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	HMGA902
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14900 91 / 1e-22 HMGA high mobility group A (.1) AT5G08780 70 / 4e-14 winged-helix DNA-binding transcription factor family protein (.1) AT3G18035 69 / 7e-14 HON4 winged-helix DNA-binding transcription factor family protein (.1) AT1G48620 67 / 4e-13 HON5 high mobility group A5 (.1) AT2G30620 54 / 5e-09 winged-helix DNA-binding transcription factor family protein (.1.2) AT1G49950 44 / 2e-05 MYB ATTRB1, TRB1 telomere repeat binding factor 1 (.1.2.3) AT2G18050 42 / 5e-05 HIS1-3 histone H1-3 (.1.2) AT1G06760 42 / 8e-05 winged-helix DNA-binding transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G129400 [exp] 191 / 4e-62 AT1G14900 102 / 2e-27 high mobility group A (.1) Potri.010G109600 [exp] 94 / 7e-24 AT1G14900 98 / 3e-25 high mobility group A (.1) Potri.008G132400 [exp] 94 / 8e-24 AT1G14900 107 / 4e-29 high mobility group A (.1) Potri.015G040200 [exp] 72 / 5e-15 AT1G48620 99 / 6e-22 high mobility group A5 (.1) Potri.012G048500 [exp] 67 / 4e-13 AT1G14900 66 / 5e-12 high mobility group A (.1) Potri.005G069700 [exp] 59 / 3e-10 AT5G08780 83 / 3e-16 winged-helix DNA-binding transcription factor family protein (.1) Potri.002G199900 [exp] 57 / 3e-10 AT2G30620 84 / 4e-20 winged-helix DNA-binding transcription factor family protein (.1.2) Potri.005G116600 [exp] 52 / 2e-08 AT2G18050 117 / 3e-33 histone H1-3 (.1.2) Potri.008G162300 [exp] 50 / 6e-08 AT2G30620 76 / 2e-17 winged-helix DNA-binding transcription factor family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004056 [exp] 81 / 7e-19 AT1G14900 104 / 5e-28 high mobility group A (.1) Lus10002284 [exp] 77 / 9e-18 AT1G14900 108 / 6e-30 high mobility group A (.1) Lus10032231 [exp] 66 / 2e-12 AT1G48620 103 / 2e-23 high mobility group A5 (.1) Lus10024594 [exp] 65 / 2e-12 AT3G18035 132 / 3e-33 winged-helix DNA-binding transcription factor family protein (.1) Lus10006561 [exp] 57 / 7e-10 AT2G30620 115 / 1e-31 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10005535 [exp] 56 / 2e-09 AT2G30620 124 / 8e-35 winged-helix DNA-binding transcription factor family protein (.1.2) Lus10004328 [exp] 52 / 7e-08 AT3G18035 129 / 2e-32 winged-helix DNA-binding transcription factor family protein (.1) Lus10028911 [exp] 49 / 4e-07 AT1G48620 128 / 4e-32 high mobility group A5 (.1) Lus10025968 [exp] 48 / 1e-06 AT2G18050 132 / 6e-39 histone H1-3 (.1.2) Lus10033775 [exp] 40 / 0.0006 AT5G15340 635 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00538 [poplar] [flax] Linker_histone linker histone H1 and H5 family CL0123 [poplar] [flax] PF02178 [poplar] [flax] AT_hook AT hook motif
Representative CDS sequence Show only first row Show all	>Potri.004G087500.3 pacid=42796030 polypeptide=Potri.004G087500.3.p locus=Potri.004G087500 ID=Potri.004G087500.3.v4.1 annot-version=v4.1 ATGGCAGCTGAGGAGATTAGTAAGCCTCCATCACTCCCTCCTTACCCTGAGATGATTTGGTCAGCCATTGCAGCATTGAATGAGACGGGTGGCTCTAACA AGACATCAATATCGAAATACATTGAATCAAAACACGGGAACTTGCCGGCTGGCCACACAGCTCTCCTCGCACACCACCTCAATCGAATGACGGATACCGG AGAGTTAATGTTTTTGAAAAACAACTACATGAAGCCAGATCCCAATGCTCCTCCAAGGCGTGGTCGTGGTAGGCCCCCAAAGCCCAAGGATCCACTTGCA CCACCCGCAGACCTGGCCCCCGCCAGACCGAGGGGTCGTCCACCAAAGGATCCAAATGCACCACCAAAGCCAGTGAAGCCGAAGGCTACCACTGCGGGAA GTGGAAAGCCAAGAGGGAGGCCACGCAAGATGGCACGACCCACCGGAGGAATAACCGGAACACCTACAGCTACCTCAGCAGTTCCAATGACAACAGGTAG TGGAAGGCCAAGGGGTCGGCCTCCAAAGGTGAAGGCTGCTGCTATGACTGAAGTGAGTGTTCAGAATTAG
AA sequence Show only first row Show all	>Potri.004G087500.3 pacid=42796030 polypeptide=Potri.004G087500.3.p locus=Potri.004G087500 ID=Potri.004G087500.3.v4.1 annot-version=v4.1 MAAEEISKPPSLPPYPEMIWSAIAALNETGGSNKTSISKYIESKHGNLPAGHTALLAHHLNRMTDTGELMFLKNNYMKPDPNAPPRRGRGRPPKPKDPLA PPADLAPARPRGRPPKDPNAPPKPVKPKATTAGSGKPRGRPRKMARPTGGITGTPTATSAVPMTTGSGRPRGRPPKVKAAAMTEVSVQN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14900		HMGA	high mobility group A (.1)		Potri.004G087500 [exp]	0	1	HMGA902
AT5G24650			Mitochondrial import inner mem...		Potri.015G000600 [exp]	8.12	0.8862
AT5G64380			Inositol monophosphatase famil...		Potri.017G042900 [exp]	8.88	0.9056
AT1G03475		LIN2, HEMF1, AT...	LESION INITIATION 2, Coproporp...		Potri.011G023900 [exp]	9.16	0.8781
AT5G67290			FAD-dependent oxidoreductase f...		Potri.005G060500 [exp]	14.14	0.8824
AT3G44380			Late embryogenesis abundant (L...		Potri.001G218400 [exp]	16.49	0.8919
AT2G21340			MATE efflux family protein (.1...		Potri.009G122600 [exp]	17.32	0.9019
AT5G66470			RNA binding;GTP binding (.1)		Potri.007G021900 [exp]	23.17	0.9009
AT5G24690			Protein of unknown function (D...		Potri.001G210500 [exp]	27.49	0.8543
AT1G74590		ATGSTU10	glutathione S-transferase TAU ...		Potri.008G135300 [exp]	32.93	0.8879
AT1G71730			unknown protein		Potri.005G198100 [exp]	37.10	0.8665

Compare expression of checked genes

Potri.004G087500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.