Potri.004G088550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G030700 67 / 2e-14 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G031101 64 / 1e-13 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.005G030318 61 / 1e-12 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G031899 56 / 1e-10 AT1G69550 469 / 6e-141 disease resistance protein (TIR-NBS-LRR class) (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G088550.1 pacid=42794354 polypeptide=Potri.004G088550.1.p locus=Potri.004G088550 ID=Potri.004G088550.1.v4.1 annot-version=v4.1
ATGAAGCTGCTTCTCAGCAATTCAATTTTGTCGGTTGCTTCAAATCGGATCAGAATTCATGCATTAGAATTATGTGTGATACCCGGTTATGAATTGGACA
CTTTGCAACATCACTGTTTAATCAGGAATATCTTGGTAAGCCAATTCGAGTTAGCTTATATGTGCTTGGTCGGAAGTTCCAGAGTGGTTCAGTTATATAG
AATGATGGTGACTTTGATATTAGATGTGAATGCCATTTGA
AA sequence
>Potri.004G088550.1 pacid=42794354 polypeptide=Potri.004G088550.1.p locus=Potri.004G088550 ID=Potri.004G088550.1.v4.1 annot-version=v4.1
MKLLLSNSILSVASNRIRIHALELCVIPGYELDTLQHHCLIRNILVSQFELAYMCLVGSSRVVQLYRMMVTLILDVNAI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G088550 0 1
AT3G29400 ATEXO70E1 exocyst subunit exo70 family p... Potri.017G093650 4.79 0.7670
AT4G00330 CRCK2 calmodulin-binding receptor-li... Potri.001G434200 5.83 0.6906
Potri.010G200150 11.13 0.7644
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Potri.011G113125 15.09 0.7388
AT4G01500 B3 NGA4 NGATHA4, AP2/B3-like transcrip... Potri.012G013501 15.87 0.7155
Potri.009G148700 22.44 0.7209
AT4G35880 Eukaryotic aspartyl protease f... Potri.005G108666 22.84 0.7147
AT5G19875 unknown protein Potri.003G216100 24.71 0.7022
AT4G05070 Wound-responsive family protei... Potri.004G033300 28.98 0.7122
AT2G16910 bHLH AMS, bHLH021 ABORTED MICROSPORES, basic hel... Potri.010G041500 30.75 0.6492

Potri.004G088550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.