Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03430 128 / 2e-40 Calcium-binding EF-hand family protein (.1) AT5G17480 120 / 2e-37 APC1 pollen calcium-binding protein 1 (.1) AT1G73630 68 / 8e-16 EF hand calcium-binding protein family (.1) AT1G24620 67 / 4e-15 EF hand calcium-binding protein family (.1) AT1G18210 62 / 1e-13 Calcium-binding EF-hand family protein (.1.2) AT2G15680 60 / 1e-12 AtCML30 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) AT3G51920 59 / 1e-12 CML9, CAM9, ATCML9 CALMODULIN LIKE PROTEIN 9, calmodulin 9 (.1) AT3G03000 57 / 9e-12 EF hand calcium-binding protein family (.1) AT1G66400 57 / 1e-11 CML23 calmodulin like 23 (.1) AT5G42380 56 / 4e-11 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G126400 [exp] 147 / 2e-48 AT3G03430 132 / 3e-42 Calcium-binding EF-hand family protein (.1) Potri.015G039500 [exp] 71 / 7e-17 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.010G107100 [exp] 71 / 9e-17 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1) Potri.008G134300 [exp] 70 / 2e-16 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1) Potri.012G048200 [exp] 64 / 1e-14 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.017G126200 [exp] 62 / 1e-13 AT1G66400 155 / 5e-49 calmodulin like 23 (.1) Potri.003G095700 [exp] 62 / 2e-13 AT3G03000 220 / 1e-74 EF hand calcium-binding protein family (.1) Potri.001G138000 [exp] 60 / 8e-13 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1) Potri.002G239100 [exp] 57 / 1e-11 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028519 [exp] 133 / 2e-42 AT3G03430 132 / 2e-42 Calcium-binding EF-hand family protein (.1) Lus10033587 [exp] 132 / 4e-42 AT3G03430 131 / 8e-42 Calcium-binding EF-hand family protein (.1) Lus10009124 [exp] 131 / 8e-42 AT3G03430 131 / 7e-42 Calcium-binding EF-hand family protein (.1) Lus10004330 [exp] 67 / 2e-15 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10028913 [exp] 67 / 2e-15 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10042008 [exp] 66 / 5e-15 AT1G18210 138 / 1e-42 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 64 / 3e-14 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10031345 [exp] 64 / 4e-14 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 63 / 9e-14 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10030986 [exp] 59 / 2e-12 AT1G32250 219 / 3e-74 Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.004G089200.1 pacid=42794984 polypeptide=Potri.004G089200.1.p locus=Potri.004G089200 ID=Potri.004G089200.1.v4.1 annot-version=v4.1 ATGGCTGACGAAAGGCCTGAGCTGGAGCGCATTTTCAAGCGTTTCGACTTGAATGGTGATGGCCAAATCTCTGCAGCAGAGCTCGGCGATTGCGTGAAGA CCCTCGGTTCAGTCACAGCAGAGGAGATCAAGCGCATGATGGCTGAGATTGATACTGATGGTGATGGATTCATATCATTCCAGGAGTTCTTAGATTTTGC CAAGGCTAACAGTGGCCTGATTAAAGATGTTGCTAAGATATTTTAA
AA sequence Show only first row Show all	>Potri.004G089200.1 pacid=42794984 polypeptide=Potri.004G089200.1.p locus=Potri.004G089200 ID=Potri.004G089200.1.v4.1 annot-version=v4.1 MADERPELERIFKRFDLNGDGQISAAELGDCVKTLGSVTAEEIKRMMAEIDTDGDGFISFQEFLDFAKANSGLIKDVAKIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G03430			Calcium-binding EF-hand family...		Potri.004G089200 [exp]	0	1
AT5G60020		LAC17, ATLAC17	laccase 17 (.1)		Potri.001G401100 [exp]	4.24	0.8524
AT1G21280			unknown protein		Potri.006G109250 [exp]	15.68	0.8432
AT2G37150			RING/U-box superfamily protein...		Potri.008G041201 [exp]	24.91	0.8370
					Potri.019G129150 [exp]	31.30	0.8016
AT1G66680		AR401	S-adenosyl-L-methionine-depend...		Potri.012G068600 [exp]	35.74	0.8291
AT5G12920			Transducin/WD40 repeat-like su...		Potri.001G016800 [exp]	49.49	0.8081
AT4G02550			unknown protein		Potri.001G157750 [exp]	54.11	0.7958
AT3G18660		PGSIP1, GUX1	glucuronic acid substitution o...		Potri.007G107200 [exp]	62.32	0.8079
					Potri.019G129820 [exp]	68.35	0.7708
AT3G14470			NB-ARC domain-containing disea...		Potri.012G121725 [exp]	69.19	0.8022

Compare expression of checked genes

Potri.004G089200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.