Potri.004G090666 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16715 80 / 1e-18 EMB2247 embryo defective 2247, ATP binding;valine-tRNA ligases;aminoacyl-tRNA ligases;nucleotide binding;ATP binding;aminoacyl-tRNA ligases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G124500 156 / 2e-45 AT5G16715 1627 / 0.0 embryo defective 2247, ATP binding;valine-tRNA ligases;aminoacyl-tRNA ligases;nucleotide binding;ATP binding;aminoacyl-tRNA ligases (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028505 94 / 9e-24 AT5G16715 1520 / 0.0 embryo defective 2247, ATP binding;valine-tRNA ligases;aminoacyl-tRNA ligases;nucleotide binding;ATP binding;aminoacyl-tRNA ligases (.1)
Lus10009139 92 / 7e-23 AT5G16715 1128 / 0.0 embryo defective 2247, ATP binding;valine-tRNA ligases;aminoacyl-tRNA ligases;nucleotide binding;ATP binding;aminoacyl-tRNA ligases (.1)
PFAM info
Representative CDS sequence
>Potri.004G090666.1 pacid=42795923 polypeptide=Potri.004G090666.1.p locus=Potri.004G090666 ID=Potri.004G090666.1.v4.1 annot-version=v4.1
ATGAGACTCTCTTCTTCATTTCTCCTATCTTCTTGTTCCCCTGCCCACAGGCTCAATCCTCTTCTCTTCTCTAAACGACGCCGTTGCCCCATCAAACTCT
CTCACTTCCGTTTCAATCTTCTCACCAAACCCAGATTCTTTACAGTTGCTGTTTCTGCAACAGAAAATGGTGTATTTACTTCCCCAGAAATCGCAAGGTC
ATTTGATTTTTCTTCAGAAGAACGAATTTACAACCGGTGGGAATCTCAAGGATTTTTTAAGCCAAGTTTTGACCGGGGGAGTGATCCTTTTGTGGTTTCA
ACAGCTTTTGAGCCACCGCTCAGCTAG
AA sequence
>Potri.004G090666.1 pacid=42795923 polypeptide=Potri.004G090666.1.p locus=Potri.004G090666 ID=Potri.004G090666.1.v4.1 annot-version=v4.1
MRLSSSFLLSSCSPAHRLNPLLFSKRRRCPIKLSHFRFNLLTKPRFFTVAVSATENGVFTSPEIARSFDFSSEERIYNRWESQGFFKPSFDRGSDPFVVS
TAFEPPLS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G16715 EMB2247 embryo defective 2247, ATP bin... Potri.004G090666 0 1
Potri.010G228883 4.69 0.9113
AT5G04290 SPT5L, KTF1 SPT5-LIKE, kow domain-containi... Potri.010G228766 4.89 0.9015
AT2G18220 Noc2p family (.1) Potri.003G213601 8.06 0.8966
AT4G27680 P-loop containing nucleoside t... Potri.012G027000 8.12 0.8818
AT5G06350 ARM repeat superfamily protein... Potri.011G095700 12.24 0.8889
AT2G26100 Galactosyltransferase family p... Potri.018G053150 15.87 0.8734
AT5G40820 ATATR, ATRAD3, ... ARABIDOPSIS THALIANA ATAXIA TE... Potri.004G179000 17.94 0.8584
AT2G17930 Phosphatidylinositol 3- and 4-... Potri.007G057900 18.38 0.8720
AT2G18220 Noc2p family (.1) Potri.003G213450 21.56 0.8698
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Potri.010G230200 22.27 0.8427

Potri.004G090666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.