Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G37930 142 / 4e-41 Protein with RING/U-box and TRAF-like domains (.1) AT5G37890 122 / 7e-34 Protein with RING/U-box and TRAF-like domains (.1) AT5G37870 107 / 3e-28 Protein with RING/U-box and TRAF-like domains (.1) AT5G37910 106 / 6e-28 Protein with RING/U-box and TRAF-like domains (.1) AT1G66620 106 / 1e-27 Protein with RING/U-box and TRAF-like domains (.1) AT1G66650 103 / 2e-26 Protein with RING/U-box and TRAF-like domains (.1) AT1G66660 101 / 2e-25 Protein with RING/U-box and TRAF-like domains (.1.2) AT1G66630 96 / 1e-23 Protein with RING/U-box and TRAF-like domains (.1) AT5G62800 92 / 5e-22 Protein with RING/U-box and TRAF-like domains (.1) AT2G41980 73 / 3e-15 Protein with RING/U-box and TRAF-like domains (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G148100 [exp] 229 / 4e-74 AT5G37930 206 / 4e-63 Protein with RING/U-box and TRAF-like domains (.1) Potri.017G122800 [exp] 221 / 6e-71 AT5G37930 180 / 5e-53 Protein with RING/U-box and TRAF-like domains (.1) Potri.004G072800 [exp] 217 / 1e-69 AT5G37930 173 / 9e-51 Protein with RING/U-box and TRAF-like domains (.1) Potri.004G091800 [exp] 122 / 3e-32 AT5G37930 81 / 4e-16 Protein with RING/U-box and TRAF-like domains (.1) Potri.014G099200 [exp] 72 / 6e-15 AT3G61790 551 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.002G171500 [exp] 72 / 1e-14 AT3G61790 558 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.012G015500 [exp] 69 / 8e-14 AT4G27880 542 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.016G059700 [exp] 68 / 2e-13 AT3G58040 548 / 0.0 seven in absentia of Arabidopsis 2 (.1) Potri.015G013000 [exp] 68 / 3e-13 AT4G27880 546 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009111 [exp] 196 / 2e-63 AT5G37930 134 / 5e-38 Protein with RING/U-box and TRAF-like domains (.1) Lus10028535 [exp] 195 / 5e-63 AT5G37930 134 / 7e-38 Protein with RING/U-box and TRAF-like domains (.1) Lus10013739 [exp] 76 / 2e-16 AT3G58040 493 / 6e-178 seven in absentia of Arabidopsis 2 (.1) Lus10039202 [exp] 76 / 3e-16 AT3G58040 488 / 1e-175 seven in absentia of Arabidopsis 2 (.1) Lus10030248 [exp] 69 / 2e-13 AT3G61790 514 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10004001 [exp] 68 / 2e-13 AT3G61790 525 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10022405 [exp] 68 / 3e-13 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10018110 [exp] 68 / 3e-13 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10016348 [exp] 66 / 1e-12 AT3G61790 459 / 7e-163 Protein with RING/U-box and TRAF-like domains (.1) Lus10002761 [exp] 66 / 2e-12 AT3G61790 462 / 1e-164 Protein with RING/U-box and TRAF-like domains (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0389 [poplar] [flax] TRAF PF03145 [poplar] [flax] Sina Seven in absentia protein family
Representative CDS sequence Show only first row Show all	>Potri.004G091900.3 pacid=42793890 polypeptide=Potri.004G091900.3.p locus=Potri.004G091900 ID=Potri.004G091900.3.v4.1 annot-version=v4.1 ATGAATGGACACGCTGCTTGCTCTTCATGCTGCAGTAAACTTGCACATATATGTCCTTCCTGCTCATTGCCTATTGGTTATATTCATTGCCTGGCCATTG AGAAGGTTCTTGAATCAGCCAAAATATCATGCCAAAATATGAAGTATGGGTGCAAAGAAACTGTCAGTTACAGCAAGAAGTGTGACCATGAGAAGAGCTG CATCTATGCAACATGCTCCTGCCCAGTGTCAGGCTGCAGCTTTGTCAGCTCATCAAAGCAGTTATACTCACATTTAAGCAGCACACATGTAGGTGATGTG AAACACTTTGAGTATGATTGCAAAATCCCCGTTTCCTTTACCGCAAGTAAGAAATTTGTTGTTCTCCAAGAAAAGAAAGAAGGCGTTGTATTCATCCTGA ACAATGCTTTGCAAATCATGGGGAATGTGATCATGGTTAGTTGCATAGGGCCCTCATCCAAGGGAGGATACTTCTATGAACTTTCAGCAAACAGTAAAGG AAACAGTCTCATTTTTCGATCTTTTACACCTTGCTTTCGGAGCAGGGTTGATAACCCTCCTTCAGTGAGGTTCCTCCTAGTTCCAGGTGGGTTTTTTGGT TCTGGGGAGAAGGTTACCTTGGATCTCTGCATATGGGCGTAA
AA sequence Show only first row Show all	>Potri.004G091900.3 pacid=42793890 polypeptide=Potri.004G091900.3.p locus=Potri.004G091900 ID=Potri.004G091900.3.v4.1 annot-version=v4.1 MNGHAACSSCCSKLAHICPSCSLPIGYIHCLAIEKVLESAKISCQNMKYGCKETVSYSKKCDHEKSCIYATCSCPVSGCSFVSSSKQLYSHLSSTHVGDV KHFEYDCKIPVSFTASKKFVVLQEKKEGVVFILNNALQIMGNVIMVSCIGPSSKGGYFYELSANSKGNSLIFRSFTPCFRSRVDNPPSVRFLLVPGGFFG SGEKVTLDLCIWA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G37930			Protein with RING/U-box and TR...		Potri.004G091900 [exp]	0	1
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.011G114700 [exp]	1.00	0.6500
					Potri.018G031250 [exp]	11.53	0.5875
AT1G57775			Protein of unknown function (D...		Potri.004G115201 [exp]	13.74	0.5663
					Potri.005G133550 [exp]	14.69	0.5405
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Potri.006G121600 [exp]	16.91	0.5659
AT1G57775			Protein of unknown function (D...		Potri.004G115100 [exp]	17.54	0.5199
AT1G57775			Protein of unknown function (D...		Potri.004G115150 [exp]	24.73	0.4596
AT1G74220			unknown protein		Potri.012G061700 [exp]	27.03	0.4836
AT5G05070			DHHC-type zinc finger family p...		Potri.016G025200 [exp]	65.36	0.4275
AT3G05675			BTB/POZ domain-containing prot...		Potri.016G069566 [exp]	66.33	0.3746

Compare expression of checked genes

Potri.004G091900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.