Potri.004G094850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G093400 126 / 2e-36 AT1G71140 482 / 8e-168 MATE efflux family protein (.1)
Potri.004G094700 124 / 3e-35 AT2G04100 425 / 3e-145 MATE efflux family protein (.1)
Potri.010G116900 56 / 1e-10 AT1G15170 598 / 0.0 MATE efflux family protein (.1)
Potri.017G120600 55 / 1e-10 AT1G66760 468 / 2e-162 MATE efflux family protein (.1.2)
Potri.017G120500 54 / 6e-10 AT2G04100 468 / 3e-162 MATE efflux family protein (.1)
Potri.004G094900 39 / 8e-05 AT1G71140 503 / 3e-176 MATE efflux family protein (.1)
Potri.017G120400 38 / 0.0001 AT2G04100 508 / 3e-178 MATE efflux family protein (.1)
Potri.010G117000 38 / 0.0002 AT1G15170 545 / 0.0 MATE efflux family protein (.1)
Potri.004G094800 37 / 0.0003 AT2G04100 479 / 2e-167 MATE efflux family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009132 60 / 4e-12 AT2G04040 489 / 9e-171 detoxification 1, MATE efflux family protein (.1)
Lus10041053 46 / 2e-07 AT1G71140 395 / 5e-134 MATE efflux family protein (.1)
Lus10013626 45 / 9e-07 AT1G33110 365 / 2e-123 MATE efflux family protein (.1.2)
Lus10008911 44 / 2e-06 AT1G71140 430 / 1e-147 MATE efflux family protein (.1)
Lus10006171 43 / 3e-06 AT1G71140 452 / 5e-154 MATE efflux family protein (.1)
Lus10042732 42 / 9e-06 AT1G15170 562 / 0.0 MATE efflux family protein (.1)
Lus10029694 40 / 3e-05 AT1G15170 563 / 0.0 MATE efflux family protein (.1)
Lus10003869 36 / 0.0008 AT1G33110 670 / 0.0 MATE efflux family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.004G094850.1 pacid=42795265 polypeptide=Potri.004G094850.1.p locus=Potri.004G094850 ID=Potri.004G094850.1.v4.1 annot-version=v4.1
ATGGCAGAAAATAGGGGCATATATCAATCTTGGTTCATTTTATCTGGTTGGACTTCCAGTGGCTGCTGTGCTTGGTTTTGTAGCTCATTTAAGAGGAAAA
GGCCTTTGGATTGGAATATTAGCTGGGTCCTTCGTGCAATCAGTTCTTCTTTCTATCGTTACTGCTTGTACAGATTGGAACAAACAGGCAACAAAGGCAA
GGGAAAGGGTATTTGA
AA sequence
>Potri.004G094850.1 pacid=42795265 polypeptide=Potri.004G094850.1.p locus=Potri.004G094850 ID=Potri.004G094850.1.v4.1 annot-version=v4.1
MAENRGIYQSWFILSGWTSSGCCAWFCSSFKRKRPLDWNISWVLRAISSSFYRYCLYRLEQTGNKGKGKGI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G15150 MATE efflux family protein (.1... Potri.004G094850 0 1
AT1G29500 SAUR-like auxin-responsive pro... Potri.009G141000 11.57 0.9590
AT5G50700 HSD1 hydroxysteroid dehydrogenase 1... Potri.015G099900 13.41 0.9503
Potri.014G082700 15.03 0.9144
Potri.003G082300 21.49 0.9513
AT5G10770 Eukaryotic aspartyl protease f... Potri.006G232500 21.63 0.9571
AT5G10770 Eukaryotic aspartyl protease f... Potri.006G232400 24.73 0.9552
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Potri.008G165400 27.49 0.9338
AT5G46690 bHLH bHLH071 beta HLH protein 71 (.1) Potri.003G093200 33.98 0.9513
AT1G29430 SAUR-like auxin-responsive pro... Potri.009G141251 36.00 0.9239
AT1G19190 alpha/beta-Hydrolases superfam... Potri.004G142900 36.44 0.8982

Potri.004G094850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.