Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16740 107 / 4e-32 Ribosomal protein L20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G119300 [exp] 116 / 2e-35 AT1G16740 235 / 1e-81 Ribosomal protein L20 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006327 [exp] 100 / 4e-29 AT1G16740 213 / 1e-72 Ribosomal protein L20 (.1) Lus10029597 [exp] 100 / 4e-29 AT1G16740 213 / 7e-73 Ribosomal protein L20 (.1) Lus10034785 [exp] 96 / 2e-26 AT1G16740 212 / 2e-71 Ribosomal protein L20 (.1) Lus10033326 [exp] 93 / 4e-26 AT1G16740 206 / 3e-70 Ribosomal protein L20 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G095475.1 pacid=42795622 polypeptide=Potri.004G095475.1.p locus=Potri.004G095475 ID=Potri.004G095475.1.v4.1 annot-version=v4.1 ATGCTGGCACCCGCCAACATGGTTAATTATGGTAATTTCATGCATGGACTGCTGAAGGAGAGTTTTCATCTGAACAGAAAAGTCTTATCAGAGAAATCCA TGCACGAACCATATAGTTTCAAGGCCCTGGTAGACATGTCCCGCAACGCCTTTCCTGGAAACAAAAATGTGGTGCATCGTCCCAGGAAAGTGGACATTTC TTCTGTTAATGTGTAG
AA sequence Show only first row Show all	>Potri.004G095475.1 pacid=42795622 polypeptide=Potri.004G095475.1.p locus=Potri.004G095475 ID=Potri.004G095475.1.v4.1 annot-version=v4.1 MLAPANMVNYGNFMHGLLKESFHLNRKVLSEKSMHEPYSFKALVDMSRNAFPGNKNVVHRPRKVDISSVNV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G16740			Ribosomal protein L20 (.1)		Potri.004G095475 [exp]	0	1
AT1G07400			HSP20-like chaperones superfam...		Potri.009G039200 [exp]	3.87	0.9758
AT5G12020		HSP17.6II	17.6 kDa class II heat shock p...		Potri.006G223900 [exp]	4.69	0.9788	HSP17.11
AT1G45976		SBP1	S-ribonuclease binding protein...		Potri.014G027000 [exp]	7.21	0.9444	SBP1.3
AT2G29500			HSP20-like chaperones superfam...		Potri.009G049900 [exp]	8.71	0.9710
AT2G29500			HSP20-like chaperones superfam...		Potri.009G148000 [exp]	9.74	0.9699
AT5G11680			unknown protein		Potri.003G158200 [exp]	9.89	0.9661
AT5G59720		HSP18.2 HSP18.1...	heat shock protein 18.2 (.1)		Potri.008G062350 [exp]	11.22	0.9677
AT5G65490			unknown protein		Potri.006G134400 [exp]	11.61	0.9436
AT5G15250		FTSH6, ATFTSH6	FTSH protease 6 (.1.2)		Potri.017G084000 [exp]	12.36	0.9650
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Potri.013G018000 [exp]	12.64	0.9657	HSP70.11

Compare expression of checked genes

Potri.004G095475 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.