Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39050 142 / 2e-40 PMAT1 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) AT3G29590 140 / 2e-39 AT5MAT HXXXD-type acyl-transferase family protein (.1) AT3G29670 139 / 4e-39 PMAT2 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) AT3G29635 136 / 4e-38 HXXXD-type acyl-transferase family protein (.1) AT3G29680 129 / 2e-35 HXXXD-type acyl-transferase family protein (.1) AT5G39080 124 / 2e-33 HXXXD-type acyl-transferase family protein (.1) AT5G39090 122 / 1e-32 HXXXD-type acyl-transferase family protein (.1) AT5G61160 117 / 4e-31 AACT1 anthocyanin 5-aromatic acyltransferase 1 (.1) AT1G03495 102 / 3e-25 HXXXD-type acyl-transferase family protein (.1) AT1G03940 100 / 2e-24 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G096300 [exp] 417 / 5e-147 AT3G29670 311 / 1e-101 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) Potri.004G096132 [exp] 412 / 3e-145 AT3G29670 308 / 2e-100 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) Potri.004G096200 [exp] 352 / 2e-125 AT5G39050 133 / 7e-37 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G096066 [exp] 343 / 4e-118 AT5G39050 273 / 2e-86 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G093800 [exp] 259 / 2e-85 AT5G39080 302 / 4e-98 HXXXD-type acyl-transferase family protein (.1) Potri.001G455150 [exp] 195 / 9e-63 AT5G39050 191 / 7e-58 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103300 [exp] 197 / 4e-61 AT5G39050 352 / 3e-117 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.010G208100 [exp] 197 / 6e-61 AT5G39050 332 / 3e-109 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103200 [exp] 197 / 6e-61 AT5G39050 374 / 1e-125 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033599 [exp] 162 / 1e-47 AT3G29635 307 / 1e-99 HXXXD-type acyl-transferase family protein (.1) Lus10021390 [exp] 146 / 2e-41 AT3G29590 283 / 7e-91 HXXXD-type acyl-transferase family protein (.1) Lus10020721 [exp] 143 / 3e-40 AT5G39050 280 / 2e-89 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10041656 [exp] 138 / 4e-39 AT3G29590 242 / 6e-76 HXXXD-type acyl-transferase family protein (.1) Lus10041657 [exp] 134 / 4e-39 AT3G29590 143 / 3e-40 HXXXD-type acyl-transferase family protein (.1) Lus10041658 [exp] 139 / 7e-39 AT3G29590 298 / 2e-96 HXXXD-type acyl-transferase family protein (.1) Lus10005362 [exp] 138 / 2e-38 AT3G29635 292 / 4e-94 HXXXD-type acyl-transferase family protein (.1) Lus10020514 [exp] 134 / 7e-37 AT3G29590 296 / 9e-96 HXXXD-type acyl-transferase family protein (.1) Lus10029276 [exp] 129 / 2e-35 AT5G39050 314 / 1e-102 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10021388 [exp] 129 / 3e-35 AT3G29635 278 / 3e-88 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [poplar] [flax] CoA-acyltrans PF02458 [poplar] [flax] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Potri.004G096425.1 pacid=42795527 polypeptide=Potri.004G096425.1.p locus=Potri.004G096425 ID=Potri.004G096425.1.v4.1 annot-version=v4.1 ATGGTAAAGTCTCAACTGGATAATTTTGGATCCAAAGAGGAAACAAATCAAACAAAGCCAATACATTTGTCGACTTATGTGCTTGTATATGCATATACGT TGGTTTGCATGCTTGAAGCAAAAGGCTTAAATAGCAATGATAAGATTAAAATCTTGATTACGGTAGACTGTAGACCCCGTTTAAACCCTCCATTACCTAA GAATTATATTGGTAATTGTGTTAGCTCCTTTGATGTGGTTGTGGAAGGAGAAGATCTAATGAAAGAGAATGGGGTTGCGTATGTTGCGAAGAGGCTTACT GAGATGATAAAAGGATTAGAGAATAGATCAGTTTTTGAGGGAGCAAAGGAGAGGTTACCATACAATGACTGGGAACCAGATATTCGACAGGTTCGAGCTG CTGGGACAAACCGATTTGGGATGTATGGGGCAGATTTTGGATGGGGGAAGCCAAGCAATGTGGAGGTTACGACCATAGATAGATTGGATGCCTTTTCTAT TATGGAGAGCAAAGACGAAAGTGGTGGAGTTGAAGTTGGTTTAGTCTTGAAGGAGCATGAAATGAAACTATTCGGTTCTCTATTTGCCAGTGGCCTTCGA ATGTAA
AA sequence Show only first row Show all	>Potri.004G096425.1 pacid=42795527 polypeptide=Potri.004G096425.1.p locus=Potri.004G096425 ID=Potri.004G096425.1.v4.1 annot-version=v4.1 MVKSQLDNFGSKEETNQTKPIHLSTYVLVYAYTLVCMLEAKGLNSNDKIKILITVDCRPRLNPPLPKNYIGNCVSSFDVVVEGEDLMKENGVAYVAKRLT EMIKGLENRSVFEGAKERLPYNDWEPDIRQVRAAGTNRFGMYGADFGWGKPSNVEVTTIDRLDAFSIMESKDESGGVEVGLVLKEHEMKLFGSLFASGLR M

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G096425 [exp]	0	1
AT3G29670		PMAT2	phenolic glucoside malonyltran...		Potri.004G096300 [exp]	1.41	0.9968
AT3G29670		PMAT2	phenolic glucoside malonyltran...		Potri.004G096132 [exp]	1.73	0.9947
					Potri.004G019733 [exp]	6.00	0.9579
AT1G76080		ATCDSP32, CDSP3...	ARABIDOPSIS THALIANA CHLOROPLA...		Potri.005G245700 [exp]	6.32	0.9631
AT2G42750			DNAJ heat shock N-terminal dom...		Potri.014G143400 [exp]	7.41	0.9629
AT5G42070			unknown protein		Potri.003G141700 [exp]	8.36	0.9577
					Potri.001G158100 [exp]	9.27	0.9410
AT5G62840			Phosphoglycerate mutase family...		Potri.015G074700 [exp]	9.89	0.9595
AT4G35090		CAT2	catalase 2 (.1.2)		Potri.002G009800 [exp]	12.96	0.9566	CAT1,Pt-CAT1.4
AT4G27700			Rhodanese/Cell cycle control p...		Potri.015G008000 [exp]	14.07	0.9604

Compare expression of checked genes

Potri.004G096425 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.