Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38280 235 / 9e-74 PR5K PR5-like receptor kinase (.1) AT4G18250 229 / 1e-70 receptor serine/threonine kinase, putative (.1) AT1G70250 226 / 1e-69 receptor serine/threonine kinase, putative (.1) AT1G66920 221 / 7e-69 Protein kinase superfamily protein (.1.2) AT1G66910 220 / 4e-68 Protein kinase superfamily protein (.1) AT5G38260 218 / 2e-67 Protein kinase superfamily protein (.1) AT5G39020 219 / 6e-67 Malectin/receptor-like protein kinase family protein (.1) AT1G66980 221 / 9e-67 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) AT1G67000 217 / 6e-66 Protein kinase superfamily protein (.1) AT5G38250 211 / 2e-65 Protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G097000 [exp] 327 / 2e-109 AT5G38260 410 / 5e-135 Protein kinase superfamily protein (.1) Potri.017G116955 [exp] 314 / 4e-105 AT1G66920 389 / 5e-128 Protein kinase superfamily protein (.1.2) Potri.017G117065 [exp] 298 / 4e-98 AT1G66920 449 / 3e-150 Protein kinase superfamily protein (.1.2) Potri.017G117010 [exp] 297 / 1e-97 AT5G38260 398 / 3e-130 Protein kinase superfamily protein (.1) Potri.017G117120 [exp] 296 / 2e-97 AT5G38260 430 / 2e-142 Protein kinase superfamily protein (.1) Potri.017G117340 [exp] 289 / 2e-94 AT5G38260 456 / 9e-153 Protein kinase superfamily protein (.1) Potri.017G117285 [exp] 289 / 2e-94 AT1G66920 439 / 2e-146 Protein kinase superfamily protein (.1.2) Potri.017G116900 [exp] 271 / 1e-87 AT1G66910 477 / 2e-160 Protein kinase superfamily protein (.1) Potri.010G120950 [exp] 260 / 1e-83 AT5G38260 371 / 3e-120 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025553 [exp] 209 / 5e-64 AT1G70250 341 / 4e-108 receptor serine/threonine kinase, putative (.1) Lus10026761 [exp] 206 / 9e-64 AT1G67000 334 / 4e-107 Protein kinase superfamily protein (.1) Lus10025547 [exp] 202 / 7e-62 AT1G66920 345 / 2e-111 Protein kinase superfamily protein (.1.2) Lus10014923 [exp] 197 / 5e-60 AT1G67000 335 / 2e-107 Protein kinase superfamily protein (.1) Lus10014924 [exp] 194 / 1e-58 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1) Lus10027006 [exp] 184 / 1e-56 AT1G66980 218 / 1e-66 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025492 [exp] 188 / 4e-56 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1) Lus10025545 [exp] 179 / 3e-55 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1) Lus10027116 [exp] 176 / 4e-55 AT5G39030 209 / 2e-63 Protein kinase superfamily protein (.1) Lus10027085 [exp] 175 / 2e-54 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.004G096800.2 pacid=42794258 polypeptide=Potri.004G096800.2.p locus=Potri.004G096800 ID=Potri.004G096800.2.v4.1 annot-version=v4.1 ATGAATGAAGTTGCGAGCATTAGCAGAACTTCCCACATGAATATAGTTACACTTTTGGGTTTCTGCTATGAGAAGACTAAAAGAGCTTTGATCTACGAAT TCATGACCAAGGGATCTTTAGACAAGTTCATATCTTATGAAGGAACCCCAGATACAAATTTTGGTTTACAATGGGAAAGGTTTTATGAAATTGCAGTTGG TATTGCTAGAGGTCTCGAGTACTTCCATAGAGGTTGTAACACTCGAATTGTGCATTTTGACATAAAGCCTCACAACATTCTTCTCGATGAAGATTTTTGT CTAAAGATCTCTGATTTTGGTCTGGCAAAGCTATGCAAGAGTAAAGTGAGTAAGGTTTCAATGATAGGTGCAAGAGGGACTGTCGATTACATAGCACCTG AAGTGTTCTGCAGAACTTTTGGAGGAGTATCTTACAAGTCTGATGTGTATAGCTATGGAATGATGGTTCTAGAAATGGTTGGAGAAAGAAAAAAAATTAT ACTGGATCTTCGGAAACTAGTGAAATGTATTTCCCTGATTGGTTCTATAAGTATCTTGAACCGGGAGAGATTACATTACTTTATGGGGGTTTATCAGAAG AGAAAGAAGAGATTATAA
AA sequence Show only first row Show all	>Potri.004G096800.2 pacid=42794258 polypeptide=Potri.004G096800.2.p locus=Potri.004G096800 ID=Potri.004G096800.2.v4.1 annot-version=v4.1 MNEVASISRTSHMNIVTLLGFCYEKTKRALIYEFMTKGSLDKFISYEGTPDTNFGLQWERFYEIAVGIARGLEYFHRGCNTRIVHFDIKPHNILLDEDFC LKISDFGLAKLCKSKVSKVSMIGARGTVDYIAPEVFCRTFGGVSYKSDVYSYGMMVLEMVGERKKIILDLRKLVKCISLIGSISILNRERLHYFMGVYQK RKKRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.004G096800 [exp]	0	1
AT3G12890		ASML2	activator of spomin::LUC2 (.1)		Potri.005G097700 [exp]	71.62	0.5886
AT4G35900	bZIP	ATBZIP14, FD-1,...	Basic-leucine zipper (bZIP) tr...		Potri.005G243400 [exp]	93.91	0.5792
					Potri.002G006501 [exp]	118.89	0.5635
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Potri.006G066150 [exp]	128.99	0.5626
AT1G15130			Endosomal targeting BRO1-like ...		Potri.010G116400 [exp]	137.90	0.5590
AT2G26270			unknown protein		Potri.006G218800 [exp]	141.98	0.5492
AT5G40100			Disease resistance protein (TI...		Potri.006G282800 [exp]	201.31	0.5284
AT3G09510			Ribonuclease H-like superfamil...		Potri.004G015067 [exp]	217.89	0.5148

Compare expression of checked genes

Potri.004G096800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.