Potri.004G098000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36470 100 / 2e-25 Plant protein of unknown function (DUF868) (.1)
AT2G27770 94 / 2e-23 Plant protein of unknown function (DUF868) (.1)
AT5G28150 68 / 6e-14 Plant protein of unknown function (DUF868) (.1)
AT3G04860 67 / 1e-13 Plant protein of unknown function (DUF868) (.1)
AT5G11000 54 / 6e-09 Plant protein of unknown function (DUF868) (.1)
AT5G48270 51 / 5e-08 Plant protein of unknown function (DUF868) (.1)
AT4G12690 46 / 4e-06 Plant protein of unknown function (DUF868) (.1), Plant protein of unknown function (DUF868) (.2)
AT3G13229 42 / 5e-05 Plant protein of unknown function (DUF868) (.1)
AT2G04220 41 / 0.0002 Plant protein of unknown function (DUF868) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G116200 222 / 4e-73 AT2G27770 249 / 2e-81 Plant protein of unknown function (DUF868) (.1)
Potri.004G187600 125 / 2e-35 AT2G27770 305 / 2e-103 Plant protein of unknown function (DUF868) (.1)
Potri.009G148300 122 / 3e-34 AT2G27770 308 / 7e-105 Plant protein of unknown function (DUF868) (.1)
Potri.013G038000 84 / 1e-19 AT5G28150 409 / 6e-145 Plant protein of unknown function (DUF868) (.1)
Potri.005G050900 84 / 1e-19 AT5G28150 417 / 2e-148 Plant protein of unknown function (DUF868) (.1)
Potri.005G210800 69 / 3e-14 AT5G28150 359 / 2e-125 Plant protein of unknown function (DUF868) (.1)
Potri.002G051600 64 / 3e-12 AT5G28150 364 / 2e-127 Plant protein of unknown function (DUF868) (.1)
Potri.006G261300 54 / 1e-08 AT5G11000 295 / 3e-97 Plant protein of unknown function (DUF868) (.1)
Potri.015G084500 46 / 5e-06 AT4G12690 254 / 1e-83 Plant protein of unknown function (DUF868) (.1), Plant protein of unknown function (DUF868) (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014372 107 / 2e-28 AT2G27770 201 / 8e-63 Plant protein of unknown function (DUF868) (.1)
Lus10023869 106 / 4e-28 AT2G27770 196 / 1e-60 Plant protein of unknown function (DUF868) (.1)
Lus10009405 77 / 6e-17 AT2G27770 234 / 5e-75 Plant protein of unknown function (DUF868) (.1)
Lus10001787 71 / 8e-15 AT5G28150 357 / 2e-124 Plant protein of unknown function (DUF868) (.1)
Lus10020240 66 / 5e-13 AT5G28150 356 / 2e-124 Plant protein of unknown function (DUF868) (.1)
Lus10022050 57 / 5e-10 AT5G28150 310 / 2e-105 Plant protein of unknown function (DUF868) (.1)
Lus10042600 55 / 3e-09 AT5G28150 310 / 3e-105 Plant protein of unknown function (DUF868) (.1)
Lus10017128 49 / 4e-07 AT5G11000 245 / 1e-78 Plant protein of unknown function (DUF868) (.1)
Lus10039183 42 / 9e-05 AT2G04220 351 / 2e-121 Plant protein of unknown function (DUF868) (.1)
Lus10027127 42 / 0.0001 AT2G04220 263 / 4e-87 Plant protein of unknown function (DUF868) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05910 DUF868 Plant protein of unknown function (DUF868)
Representative CDS sequence
>Potri.004G098000.2 pacid=42795680 polypeptide=Potri.004G098000.2.p locus=Potri.004G098000 ID=Potri.004G098000.2.v4.1 annot-version=v4.1
ATGAGGAGTATAGGAACTTGTTACAGCGAACATGCCATCAAAGTATCTGATTCGTATTGCTCAGGCCCTTCAAACCATGCCTACCTCTCCCCAAACTTTA
CCCCTTCGATCCAAGATACAGTTTCCTGTATATACAAAGTGAAACTCTCCACTCAAAAGCACCTCTTGATCACCCTCACTTGGTGGAACAAATTGATATT
CGAAGGCCTTAACATAAATATTGATGACAGCATTTCCTCTTCTTCAAGAAACAGTGCTGGTTCCGTCCACCAGCTTCAAGAAATTAAAGGCACCAGCACA
TTTCAATCTTGTAATTCAAAGATTGAAATCTTTTGGGGTGTTTCTGCTGCTTGTTTGGATGCAGGACCTGAGCCCATCAGAGGGTTTTACGTTGTTGTTT
TGGTGGACTCAGAATTGGGTCTAGTCCTTGGAGATATTGATAATGAAGAAATCAGCACAAAATGTTTGAAGAAAAAATCAGCACCATTGAGACAGACCCT
CATTGGCTTCTCGAAGTGA
AA sequence
>Potri.004G098000.2 pacid=42795680 polypeptide=Potri.004G098000.2.p locus=Potri.004G098000 ID=Potri.004G098000.2.v4.1 annot-version=v4.1
MRSIGTCYSEHAIKVSDSYCSGPSNHAYLSPNFTPSIQDTVSCIYKVKLSTQKHLLITLTWWNKLIFEGLNINIDDSISSSSRNSAGSVHQLQEIKGTST
FQSCNSKIEIFWGVSAACLDAGPEPIRGFYVVVLVDSELGLVLGDIDNEEISTKCLKKKSAPLRQTLIGFSK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G36470 Plant protein of unknown funct... Potri.004G098000 0 1
AT2G47260 WRKY ATWRKY23, WRKY2... WRKY DNA-binding protein 23 (.... Potri.014G118200 4.47 0.8773
AT1G80490 TPR1 TOPLESS-related 1 (.1.2) Potri.018G023800 5.47 0.8631
AT3G50700 C2H2ZnF ATIDD2 indeterminate(ID)-domain 2 (.1... Potri.002G208444 13.19 0.8711
AT5G19670 Exostosin family protein (.1) Potri.006G238900 19.79 0.8225
AT4G39620 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THAL... Potri.007G084750 23.36 0.8407
AT5G10970 C2H2ZnF C2H2 and C2HC zinc fingers sup... Potri.018G021400 23.74 0.8638
AT5G46060 Protein of unknown function, D... Potri.001G372900 24.00 0.8320
AT3G49690 MYB ATMYB84, RAX3 REGULATOR OF AXILLARY MERISTEM... Potri.002G113700 30.16 0.8614
AT1G24430 HXXXD-type acyl-transferase fa... Potri.010G054002 35.49 0.8622
AT5G48130 Phototropic-responsive NPH3 fa... Potri.014G164000 37.34 0.8491

Potri.004G098000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.