Potri.004G099466 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G115002 51 / 9e-10 ND /
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Representative CDS sequence
>Potri.004G099466.1 pacid=42796540 polypeptide=Potri.004G099466.1.p locus=Potri.004G099466 ID=Potri.004G099466.1.v4.1 annot-version=v4.1
ATGCTTATGAAGTATGGTTCCATTTCCAGGAGAGAGAGAACTCAACCACTAGGAGAGCGTAGTGCTGGCTCCGTGTTTAGAAATCCATCTGAATTGGGAG
TTGTAGCAGCTGAGTTGATTGAGAAAGCTGGATTGAAAGGTTTCGGAGAAGATGGAGCTATGATTTCTAACATCCACGACAACTTCTTCATAAATGCTGG
GGGTTCAACTTCCCAAGACATGCTTGACCACATTGCTTTGGCCAAGGAGAAGGTAGATCAAAAGTTTGGAGTTCAACTAAGGGAAGAAATAATACATGTT
CAACCATATTCTGATGGCTTGATTACCAACAGAAGCAAATACCAACCATGTAATCTTTGA
AA sequence
>Potri.004G099466.1 pacid=42796540 polypeptide=Potri.004G099466.1.p locus=Potri.004G099466 ID=Potri.004G099466.1.v4.1 annot-version=v4.1
MLMKYGSISRRERTQPLGERSAGSVFRNPSELGVVAAELIEKAGLKGFGEDGAMISNIHDNFFINAGGSTSQDMLDHIALAKEKVDQKFGVQLREEIIHV
QPYSDGLITNRSKYQPCNL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G099466 0 1
AT4G01470 ATTIP1.3, GAMMA... tonoplast intrinsic protein 1;... Potri.001G235300 1.00 0.8580
AT2G39210 Major facilitator superfamily ... Potri.002G133900 5.29 0.7599
AT2G19330 PIRL6 plant intracellular ras group-... Potri.006G072700 26.60 0.6950
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Potri.001G335200 33.25 0.7907
Potri.008G144650 34.98 0.7556
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Potri.001G033800 46.76 0.7843
AT4G25410 bHLH bHLH126 basic helix-loop-helix (bHLH) ... Potri.001G113400 102.10 0.7370
AT1G12580 PEPKR1 phosphoenolpyruvate carboxylas... Potri.003G120800 106.37 0.7176
Potri.017G046100 158.04 0.6923
AT4G30110 ATHMA2, HMA2 ARABIDOPSIS HEAVY METAL ATPASE... Potri.006G076900 184.44 0.6609

Potri.004G099466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.