Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16040 665 / 0 Regulator of chromosome condensation (RCC1) family protein (.1) AT3G02510 662 / 0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G63860 188 / 2e-55 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT3G26100 141 / 8e-38 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G60870 137 / 4e-36 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT5G19420 130 / 7e-33 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT5G12350 127 / 7e-32 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT3G02300 125 / 1e-31 Regulator of chromosome condensation (RCC1) family protein (.1) AT1G27060 120 / 2e-30 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G08710 120 / 2e-30 RUG1 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G113200 [exp] 744 / 0 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.007G100200 [exp] 177 / 4e-51 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.004G000600 [exp] 133 / 7e-35 AT5G60870 534 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Potri.015G009400 [exp] 134 / 1e-34 AT3G26100 809 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Potri.017G139600 [exp] 130 / 1e-32 AT1G65920 937 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.001G402800 [exp] 127 / 3e-32 AT3G15430 723 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Potri.016G101700 [exp] 126 / 5e-32 AT3G53830 547 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.012G018600 [exp] 125 / 2e-31 AT3G26100 798 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Potri.011G121900 [exp] 124 / 4e-31 AT3G15430 743 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033543 [exp] 672 / 0 AT3G02510 648 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10017581 [exp] 665 / 0 AT3G02510 636 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10039618 [exp] 176 / 1e-50 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10042215 [exp] 158 / 6e-44 AT5G60870 547 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10029536 [exp] 142 / 5e-38 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10035957 [exp] 135 / 7e-36 AT5G08710 504 / 1e-178 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10011399 [exp] 129 / 6e-33 AT3G26100 805 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10006455 [exp] 127 / 6e-32 AT3G26100 809 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10006242 [exp] 126 / 8e-32 AT3G26100 796 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10036030 [exp] 127 / 9e-32 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00415 [poplar] [flax] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Potri.004G101800.1 pacid=42795837 polypeptide=Potri.004G101800.1.p locus=Potri.004G101800 ID=Potri.004G101800.1.v4.1 annot-version=v4.1 ATGGCAACCGAGTCCTCTGTGATTGCCTGGGGATCGGGCGAGGATGGCCAACTAGGGATAGGGAACAACGAAGACAAAGAATGGGTTTGCGTTGTCAAAG CTCTCGAGCCTTACAAAGTTCGCTCTGTTGTTGCTGGAAGTCGCAACTCTCTTGCCATTTGTGATGATGGCAAGTTGTTTACTTGGGGTTGGAACCAAAG AGGGACATTAGGACATCCACCAGAGACCAAAACCGAGAACATTCCTAGCCAGGTCAAGGCTCTTGCTAATGTCAACATTGTTCAGGCGGCTATTGGTGGC TGGCATTGTTTGGCTGTTGATGATCAAGGACGTGCTTATTCTTGGGGTGGGAACGAATATGGCCAGTGTGGTGAAGAACCTGAGAGGAAAAATGACACTG GGAGGCCTTTGAGAAGGGATATAGTCATCCCCCAACGCTGTGCATCAAACCTTGTAGTTCGCCAGGTAGCTGCTGGGGGTACTCACTCTGTGGTTCTCAC ACGTGAAGGGCATGTATGGACCTGGGGTCAACCATGGCCTCCTGGAGACATAAAGCAGATATCTGTCCCTGTGCGGGTACAAGGTCTTGAAAGAGTGAGG CTCATTGCTGTTGGGGCATTTCATAATTTAGCTCTTCAAGAAGATGGAACTTTATGGGCGTGGGGTAATAATGAATATGGACAGCTCGGAACTGGTGATA CTCAGCCAAGATCACAACCTATTCTTGTCCAAGGACTTTCTGGTCTCAATTTGGTTGATATTGCTGCTGGTGGATGGCATTCTACTGCATTGACTGATGA TGGGGAGGTGTATGGTTGGGGAAGAGGTGAACACGGAAGAATGGGATTTGGAGATAATGACAAGAGCAGTAAAATGGTCCCCCAAAAGGTTAATCTTTTA GCAGGGGAGGACATTATTCAGGTATCTTGTGGCGGGACTCATTCAGTTGCGTTGACACGTGATGGGCAGATGTTTTCCTTTGGTCGAGGTGACCATGGAC GGCTTGGATATGGGAGGAATGTGACTACAGGTCAACCAATGGAAGTGCCATTAGACATCCCGCCTCCTAAAAAACTTCGTGACAATGGAGACGAGGGACA CTGGATTGCTAAACTTGTTGGTTGCGGAGGTCGCCATACTTTGGCGATCGTGGAAATGGCAGGGACTTGA
AA sequence Show only first row Show all	>Potri.004G101800.1 pacid=42795837 polypeptide=Potri.004G101800.1.p locus=Potri.004G101800 ID=Potri.004G101800.1.v4.1 annot-version=v4.1 MATESSVIAWGSGEDGQLGIGNNEDKEWVCVVKALEPYKVRSVVAGSRNSLAICDDGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANVNIVQAAIGG WHCLAVDDQGRAYSWGGNEYGQCGEEPERKNDTGRPLRRDIVIPQRCASNLVVRQVAAGGTHSVVLTREGHVWTWGQPWPPGDIKQISVPVRVQGLERVR LIAVGAFHNLALQEDGTLWAWGNNEYGQLGTGDTQPRSQPILVQGLSGLNLVDIAAGGWHSTALTDDGEVYGWGRGEHGRMGFGDNDKSSKMVPQKVNLL AGEDIIQVSCGGTHSVALTRDGQMFSFGRGDHGRLGYGRNVTTGQPMEVPLDIPPPKKLRDNGDEGHWIAKLVGCGGRHTLAIVEMAGT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G16040			Regulator of chromosome conden...		Potri.004G101800 [exp]	0	1
AT5G13520			peptidase M1 family protein (....		Potri.008G045900 [exp]	3.31	0.7857
AT3G22540			Protein of unknown function (D...		Potri.008G154500 [exp]	8.77	0.7311
AT5G05920		DHS, EDA22	embryo sac development arrest ...		Potri.003G186900 [exp]	10.09	0.7546
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Potri.002G157100 [exp]	12.80	0.7679
AT4G31140			O-Glycosyl hydrolases family 1...		Potri.006G280400 [exp]	13.78	0.6555
AT5G54660			HSP20-like chaperones superfam...		Potri.001G416200 [exp]	28.26	0.6826
AT1G19880			Regulator of chromosome conden...		Potri.002G026600 [exp]	28.30	0.7398
					Potri.006G031500 [exp]	32.06	0.6133
AT4G31120		PRMT5, SKB1 ,AT...	PROTEIN ARGININE METHYLTRANSFE...		Potri.018G000500 [exp]	33.24	0.7179
AT5G44450			methyltransferases (.1)		Potri.011G157500 [exp]	41.83	0.6312

Compare expression of checked genes

Potri.004G101800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.