Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67265 64 / 4e-16 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1) AT5G16023 60 / 2e-14 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 (.1) AT1G68825 58 / 8e-14 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT3G02493 57 / 2e-13 DVL2, RTFL19, DVL12 DEVIL 2, ROTUNDIFOLIA like 19 (.1) AT1G13245 55 / 1e-12 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1) AT3G25717 50 / 1e-10 RTFL16, DVL6 DEVIL 6, ROTUNDIFOLIA like 16 (.1) AT4G13395 43 / 1e-07 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT3G55515 41 / 7e-07 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT1G07490 42 / 8e-07 RTFL3, DVL9 DEVIL 9, ROTUNDIFOLIA like 3 (.1) AT2G36985 40 / 9e-07 DVL16, ROT4 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G112100 [exp] 87 / 3e-25 AT1G67265 62 / 1e-15 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.008G116700 [exp] 62 / 3e-15 AT1G13245 76 / 6e-21 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.010G129600 [exp] 62 / 3e-15 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.014G138900 [exp] 45 / 2e-08 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.008G035900 [exp] 44 / 5e-08 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G226250 [exp] 42 / 2e-07 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.006G125600 [exp] 40 / 1e-06 AT2G36985 75 / 3e-20 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G201700 [exp] 40 / 2e-06 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.001G242800 [exp] 40 / 2e-06 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034272 [exp] 59 / 6e-14 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 52 / 4e-11 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10034071 [exp] 51 / 1e-10 AT5G16023 56 / 2e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1) Lus10003079 [exp] 51 / 1e-10 AT5G16023 55 / 3e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1) Lus10028393 [exp] 42 / 4e-07 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10041846 [exp] 41 / 7e-07 AT4G35783 59 / 1e-13 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10002705 [exp] 41 / 1e-06 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10040784 [exp] 40 / 4e-06 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10023399 [exp] 40 / 5e-06 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10041259 [exp] 39 / 5e-06 AT1G53708 70 / 2e-17 ROTUNDIFOLIA like 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.004G102950.1 pacid=42795108 polypeptide=Potri.004G102950.1.p locus=Potri.004G102950 ID=Potri.004G102950.1.v4.1 annot-version=v4.1 ATGAAGATGATGAGCCAAGCAACCATGGAAGAGTCCAAGAAAAAGATGTCATGCAGAAGGCTTGGAGGGTACCTTAGACAACAGAAAGGCAGGCTCTACA TTATCAGGAGATGTGTAGTCATGCTACTCTGCTGGCATGACTAG
AA sequence Show only first row Show all	>Potri.004G102950.1 pacid=42795108 polypeptide=Potri.004G102950.1.p locus=Potri.004G102950 ID=Potri.004G102950.1.v4.1 annot-version=v4.1 MKMMSQATMEESKKKMSCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G67265		DVL3, RTFL21	DEVIL 3, ROTUNDIFOLIA like 21 ...		Potri.004G102950 [exp]	0	1
AT1G55790			Domain of unknown function (DU...		Potri.001G438100 [exp]	5.09	0.7934
AT1G67265		DVL3, RTFL21	DEVIL 3, ROTUNDIFOLIA like 21 ...		Potri.017G112100 [exp]	5.29	0.7792
					Potri.001G290000 [exp]	5.47	0.7341
AT3G04910		ATWNK1, ZIK4, W...	with no lysine (K) kinase 1 (....		Potri.010G087900 [exp]	8.83	0.7355
AT1G65810			P-loop containing nucleoside t...		Potri.004G077700 [exp]	9.00	0.7890
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Potri.004G081466 [exp]	12.64	0.7909
AT1G55790			Domain of unknown function (DU...		Potri.011G141700 [exp]	12.72	0.7774
AT2G45190	YABBY	FIL, YAB1, AFO	YABBY1, FILAMENTOUS FLOWER, AB...		Potri.001G120200 [exp]	17.54	0.7576
AT1G27660	bHLH	bHLH110	basic helix-loop-helix (bHLH) ...		Potri.002G032400 [exp]	18.24	0.7687
AT1G65790		ARK1	receptor kinase 1 (.1)		Potri.004G024200 [exp]	18.49	0.7461

Compare expression of checked genes

Potri.004G102950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.