Potri.004G103800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38630 301 / 3e-104 ACYB-1 cytochrome B561-1 (.1)
AT4G25570 185 / 1e-58 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G26100 159 / 1e-48 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 137 / 7e-40 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G111700 371 / 8e-132 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.008G115300 294 / 1e-101 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.012G141000 191 / 3e-61 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 189 / 2e-60 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 182 / 3e-57 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 180 / 1e-56 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 164 / 1e-50 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 159 / 1e-48 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003076 278 / 7e-96 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10034074 261 / 2e-87 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10039216 203 / 1e-65 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 194 / 4e-62 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 194 / 2e-61 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 182 / 4e-57 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10021715 146 / 3e-43 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034427 143 / 2e-42 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 133 / 2e-38 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 106 / 5e-28 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Potri.004G103800.1 pacid=42796592 polypeptide=Potri.004G103800.1.p locus=Potri.004G103800 ID=Potri.004G103800.1.v4.1 annot-version=v4.1
ATGGCAGTTCCAGTGATTAAATTCCCAACCTTGATGGTGCTGGTGAGGTTAATGGGGGTGATGGTCTCTGCTCTGGTGTTGACGTGGACTGTTCATTACA
GAGGAGGATTGGCTCTTGTCTCTGATAACAAAGATCTCATCTTTAATGTACATCCTGTTTTGATGGTGATTGGGCTTGTACTCTTGAATGGTGAAGCCAT
GCTAGCCTACAAAACGGTTTCAGGAACCAAAAGCTTCAAAAAATTAGTTCATCTGACACTACAATTCCTCGCTTTTTGTTTAAGCTTGATTGGCTTATGG
GCTGCTTGGAAATTCCATAATGACAAGGGCATCAACAATTTTTACAGCCTGCACTCTTGGTTGGGGCTAGCTTGCCTTCTCCTCTTCGGCATCCAGTGGG
CTGCTGGGTTCGTAACTTTTTGGTATCCAGGAGGCTCAAGGAATAGCAGGGCCACCTTGCTCCCATGGCATGTGTTCTTTGGGGTTTATATTTACGCCCT
TGCTGTTGCCACTGCTACTACTGGTATCTTAGAAAAAGCCACATTCCTCCAAACCAACAAAGTAATATCGCACTACTCCGCTGAAGCTTTGCTGGTGAAC
TTATTGGGTATCTTGATGATTGCTCTGGGTGGTTTAGTTGTTCTTGCAACAATTACTTCTCTGAATAGCAAAGGTGACATCCCCAGAAACGCAACAGAGT
AG
AA sequence
>Potri.004G103800.1 pacid=42796592 polypeptide=Potri.004G103800.1.p locus=Potri.004G103800 ID=Potri.004G103800.1.v4.1 annot-version=v4.1
MAVPVIKFPTLMVLVRLMGVMVSALVLTWTVHYRGGLALVSDNKDLIFNVHPVLMVIGLVLLNGEAMLAYKTVSGTKSFKKLVHLTLQFLAFCLSLIGLW
AAWKFHNDKGINNFYSLHSWLGLACLLLFGIQWAAGFVTFWYPGGSRNSRATLLPWHVFFGVYIYALAVATATTGILEKATFLQTNKVISHYSAEALLVN
LLGILMIALGGLVVLATITSLNSKGDIPRNATE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G38630 ACYB-1 cytochrome B561-1 (.1) Potri.004G103800 0 1
AT4G33410 ATSPPL1 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Potri.015G145600 1.73 0.6667
AT4G19003 VPS25 E2F/DP family winged-helix DNA... Potri.001G135700 3.46 0.6357
AT3G55520 FKBP-like peptidyl-prolyl cis-... Potri.008G057900 3.46 0.6131
AT5G63440 Protein of unknown function (D... Potri.015G094300 4.24 0.5788
AT3G07760 Sterile alpha motif (SAM) doma... Potri.014G165300 9.53 0.5739
AT2G38430 unknown protein Potri.019G029800 14.66 0.5963
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Potri.001G273000 21.44 0.5645
AT4G38280 unknown protein Potri.009G166100 40.64 0.5525
AT5G23880 ATCPSF100, EMB1... ENHANCED SILENCING PHENOTYPE 5... Potri.001G231800 41.73 0.5348 Pt-CPSF100.2
AT3G26935 DHHC-type zinc finger family p... Potri.012G103300 42.20 0.5531

Potri.004G103800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.