Potri.004G106350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53820 42 / 6e-07 Late embryogenesis abundant protein (LEA) family protein (.1)
AT5G38760 41 / 2e-06 Late embryogenesis abundant protein (LEA) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G108300 39 / 1e-05 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.017G108350 39 / 1e-05 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.017G108400 39 / 1e-05 AT5G38760 97 / 2e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107800 38 / 2e-05 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107900 38 / 2e-05 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107100 38 / 2e-05 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107500 38 / 3e-05 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107600 38 / 3e-05 AT5G38760 90 / 8e-26 Late embryogenesis abundant protein (LEA) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034081 44 / 2e-07 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10003056 40 / 7e-06 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10027298 36 / 0.0001 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10026292 36 / 0.0002 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10012179 36 / 0.0002 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10039004 35 / 0.0005 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10007566 35 / 0.0006 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10010451 35 / 0.0006 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence
>Potri.004G106350.1 pacid=42794724 polypeptide=Potri.004G106350.1.p locus=Potri.004G106350 ID=Potri.004G106350.1.v4.1 annot-version=v4.1
ATGGATTTTCACAGCACTAGTTTCCAAGCTGGCCAAGCCAAGGGCCAAGCTCAGGAAAAGACCAGCCAGTTTATGGACAAAGCTTCCAATGCTGCCCAGT
CTGCCATGGAATCATGCCAAGAGACTGGTCAGCAAATAAAGGCTAAAGCACAAGGAGCTGCTGAAACTGTTAAGAGCAAAGTTAGTGCAAACAAATGA
AA sequence
>Potri.004G106350.1 pacid=42794724 polypeptide=Potri.004G106350.1.p locus=Potri.004G106350 ID=Potri.004G106350.1.v4.1 annot-version=v4.1
MDFHSTSFQAGQAKGQAQEKTSQFMDKASNAAQSAMESCQETGQQIKAKAQGAAETVKSKVSANK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G53820 Late embryogenesis abundant pr... Potri.004G106350 0 1
Potri.012G116401 2.44 0.8077
AT3G04900 Heavy metal transport/detoxifi... Potri.001G326100 5.91 0.7467
AT3G22600 Bifunctional inhibitor/lipid-t... Potri.002G050400 11.48 0.6853
AT5G65090 DER4, MRH3, BST... DEFORMED ROOT HAIRS 4, BRISTLE... Potri.007G090200 15.49 0.6406
Potri.009G102600 18.97 0.5787
AT2G22440 unknown protein Potri.001G266504 21.54 0.6051
AT4G09720 AtRABG3a RAB GTPase homolog G3A (.1.2.3... Potri.007G079700 21.97 0.6291
AT1G21430 YUC11 Flavin-binding monooxygenase f... Potri.016G003300 24.81 0.6057 FML10
AT2G14760 bHLH bHLH084 basic helix-loop-helix (bHLH) ... Potri.009G089000 27.82 0.6449
AT1G15125 S-adenosyl-L-methionine-depend... Potri.007G089500 30.62 0.6657

Potri.004G106350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.