Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02468 64 / 5e-16 CPuORF9 conserved peptide upstream open reading frame 9 (.1) AT5G15948 64 / 9e-16 CPuORF10 conserved peptide upstream open reading frame 10 (.1) AT3G25572 61 / 1e-14 CPuORF11 conserved peptide upstream open reading frame 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G108901 [exp] 74 / 2e-19 AT5G15948 67 / 3e-16 conserved peptide upstream open reading frame 10 (.1) Potri.010G133850 [exp] 71 / 8e-19 AT3G02468 70 / 3e-18 conserved peptide upstream open reading frame 9 (.1) Potri.018G101400 [exp] 66 / 1e-16 AT3G02468 61 / 1e-14 conserved peptide upstream open reading frame 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035082 [exp] 71 / 2e-18 AT5G15948 72 / 3e-19 conserved peptide upstream open reading frame 10 (.1) Lus10031918 [exp] 71 / 2e-18 AT5G15948 72 / 3e-19 conserved peptide upstream open reading frame 10 (.1) Lus10034412 [exp] 57 / 2e-11 AT3G25570 481 / 3e-170 Adenosylmethionine decarboxylase family protein (.1.2) Lus10000156 [exp] 57 / 2e-11 AT3G25570 486 / 3e-172 Adenosylmethionine decarboxylase family protein (.1.2) Lus10019146 [exp] 57 / 2e-11 AT3G25570 478 / 3e-169 Adenosylmethionine decarboxylase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08132 [poplar] [flax] AdoMetDC_leader S-adenosyl-l-methionine decarboxylase leader peptide
Representative CDS sequence Show only first row Show all	>Potri.004G106750.1 pacid=42795224 polypeptide=Potri.004G106750.1.p locus=Potri.004G106750 ID=Potri.004G106750.1.v4.1 annot-version=v4.1 ATGGAGTCTAAAGGTGGCAAGAAGTCTAGTAGTAGTAGTAGTAGTAAATCCTTATTGTACGAAGCACCTCTCGGCTACAGCATTGAAGACATCAGACCTG CCGGTGGAATCAAGAAGTTCCGATCTGCTGCTTACTCCAACTGCGTTCGGAAGCCATCCTGA
AA sequence Show only first row Show all	>Potri.004G106750.1 pacid=42795224 polypeptide=Potri.004G106750.1.p locus=Potri.004G106750 ID=Potri.004G106750.1.v4.1 annot-version=v4.1 MESKGGKKSSSSSSSKSLLYEAPLGYSIEDIRPAGGIKKFRSAAYSNCVRKPS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G02468		CPuORF9	conserved peptide upstream ope...		Potri.004G106750 [exp]	0	1
AT5G55340			MBOAT (membrane bound O-acyl t...		Potri.008G145700 [exp]	1.73	0.9005
					Potri.016G041301 [exp]	2.00	0.9248
AT2G41060			RNA-binding (RRM/RBD/RNP motif...		Potri.005G081600 [exp]	3.00	0.8719
AT2G40780			Nucleic acid-binding, OB-fold-...		Potri.019G061200 [exp]	3.87	0.8876
AT5G54470	CO		B-box type zinc finger family ...		Potri.001G414700 [exp]	4.00	0.8749
AT1G07310			Calcium-dependent lipid-bindin...		Potri.001G249300 [exp]	4.47	0.8924
AT4G02425			unknown protein		Potri.014G129500 [exp]	4.89	0.8354
AT4G08960			phosphotyrosyl phosphatase act...		Potri.002G099000 [exp]	5.47	0.8254
AT4G00335		RHB1A	RING-H2 finger B1A (.1.2.3)		Potri.014G087000 [exp]	7.48	0.8043
AT5G23090	CCAAT	NF-YB13	"nuclear factor Y, subunit B13...		Potri.012G058200 [exp]	9.38	0.8368	Pt-DR1.2

Compare expression of checked genes

Potri.004G106750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.