Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38760 90 / 6e-26 Late embryogenesis abundant protein (LEA) family protein (.1) AT5G53820 84 / 2e-23 Late embryogenesis abundant protein (LEA) family protein (.1) AT3G02480 53 / 3e-11 Late embryogenesis abundant protein (LEA) family protein (.1) AT1G52690 40 / 3e-05 LEA7 LATE EMBRYOGENESIS ABUNDANT 7, Late embryogenesis abundant protein (LEA) family protein (.1), Late embryogenesis abundant protein (LEA) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G107800 [exp] 123 / 4e-39 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107900 [exp] 123 / 4e-39 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107100 [exp] 123 / 4e-39 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107500 [exp] 120 / 4e-38 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108350 [exp] 110 / 4e-34 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108300 [exp] 110 / 4e-34 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108400 [exp] 109 / 1e-33 AT5G38760 97 / 2e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107700 [exp] 100 / 7e-30 AT5G53820 75 / 6e-20 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108500 [exp] 82 / 1e-22 AT5G38760 56 / 9e-12 Late embryogenesis abundant protein (LEA) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034100 [exp] 91 / 3e-26 AT5G38760 89 / 2e-25 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034081 [exp] 80 / 9e-22 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003046 [exp] 79 / 2e-21 AT5G38760 82 / 1e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10027298 [exp] 78 / 4e-21 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10010451 [exp] 78 / 5e-21 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10039004 [exp] 77 / 9e-21 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10007566 [exp] 73 / 4e-19 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10012179 [exp] 72 / 1e-18 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003056 [exp] 71 / 4e-18 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10026292 [exp] 61 / 3e-14 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G107600.2 pacid=42795359 polypeptide=Potri.004G107600.2.p locus=Potri.004G107600 ID=Potri.004G107600.2.v4.1 annot-version=v4.1 ATGGCTGACAACACCCAGAAGATGAGCTACCAAGCTGGTGAGACCAAAGGCCAAGCTCAGGAGAAGGCCAGCAACTTGATGGACAGAGCTGACAATGCTG CTCAATCTGCAAAGGAATCAGTGCAAGAGGCTGGTCAGCAGGTGAGGGCTAAGACACAGGAAGCTGTTGAAGGAGTAAAGAATGCAACTGGCATGAACAA GTGA
AA sequence Show only first row Show all	>Potri.004G107600.2 pacid=42795359 polypeptide=Potri.004G107600.2.p locus=Potri.004G107600 ID=Potri.004G107600.2.v4.1 annot-version=v4.1 MADNTQKMSYQAGETKGQAQEKASNLMDRADNAAQSAKESVQEAGQQVRAKTQEAVEGVKNATGMNK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G38760			Late embryogenesis abundant pr...		Potri.004G107600 [exp]	0	1
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Potri.011G040200 [exp]	1.00	0.9895
AT1G75700		HVA22G	HVA22-like protein G (.1)		Potri.004G166800 [exp]	2.00	0.9849
AT5G01680		ATCHX26	cation/H+ exchanger 26, ARABID...		Potri.016G127800 [exp]	3.31	0.7500	ATCHX27.1
					Potri.006G119250 [exp]	3.46	0.9244
AT3G19620			Glycosyl hydrolase family prot...		Potri.007G114300 [exp]	4.24	0.8842
AT2G33690			Late embryogenesis abundant pr...		Potri.005G145200 [exp]	4.47	0.9080
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Potri.010G104100 [exp]	7.07	0.7655
					Potri.001G105150 [exp]	7.74	0.7265
AT5G38760			Late embryogenesis abundant pr...		Potri.004G107500 [exp]	26.15	0.7994
AT4G33880	bHLH	RSL2, bHLH085	ROOT HAIR DEFECTIVE 6-LIKE 2 (...		Potri.002G119200 [exp]	31.30	0.7283

Compare expression of checked genes

Potri.004G107600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.