Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25760 56 / 3e-11 ATGDU2 glutamine dumper 2 (.1) AT5G57685 54 / 2e-10 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) AT2G24762 53 / 7e-10 ATGDU4 glutamine dumper 4 (.1) AT4G31730 50 / 7e-09 ATGDU1, GDU1 glutamine dumper 1 (.1) AT5G38770 47 / 3e-08 ATGDU7 glutamine dumper 7 (.1) AT5G24920 37 / 0.0006 ATGDU5 glutamine dumper 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G107300 [exp] 122 / 2e-37 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1) Potri.004G108680 [exp] 95 / 7e-27 AT2G24762 63 / 1e-13 glutamine dumper 4 (.1) Potri.017G107200 [exp] 90 / 6e-25 AT5G57685 63 / 9e-14 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Potri.017G107400 [exp] 82 / 1e-21 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1) Potri.004G108800 [exp] 56 / 2e-11 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1) Potri.004G108440 [exp] 55 / 4e-11 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1) Potri.018G013600 [exp] 55 / 1e-10 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1) Potri.017G107100 [exp] 53 / 2e-10 AT5G24920 48 / 2e-08 glutamine dumper 5 (.1) Potri.006G173901 [exp] 51 / 5e-09 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008909 [exp] 52 / 6e-10 AT5G57685 87 / 2e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10019985 [exp] 54 / 7e-10 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10019986 [exp] 54 / 8e-10 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10015513 [exp] 53 / 9e-10 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10020107 [exp] 50 / 8e-09 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1) Lus10026911 [exp] 50 / 1e-08 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1) Lus10006986 [exp] 50 / 1e-08 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10008910 [exp] 50 / 1e-08 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10006987 [exp] 44 / 2e-06 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G108560.1 pacid=42793874 polypeptide=Potri.004G108560.1.p locus=Potri.004G108560 ID=Potri.004G108560.1.v4.1 annot-version=v4.1 ATGAGGCCCGTTACCAACTCAATTATTGGAGGTGGTGGTGTTCATTGGAGATTCTGGCAGTGGAATTCACTTGCTGCTTACCTCTTTGTTGGTCTAGCAT TTATGCTGGGGCTTGTTACTGTAGCTTTGATAATTCTTGCCTTCTCTTATAGAAAATCTTTGTCTAATTCATCATCGGGAACTGAGGCTGAATCGGATGA AAAGCCAGCAAAGCAAGTGGATTTTGAGCCAGAGATTGTTGTGATCATGGCTGGCGATGAGAATCGAACATATCAAAATACCAAAACACCTTGGTGGTAC TGA
AA sequence Show only first row Show all	>Potri.004G108560.1 pacid=42793874 polypeptide=Potri.004G108560.1.p locus=Potri.004G108560 ID=Potri.004G108560.1.v4.1 annot-version=v4.1 MRPVTNSIIGGGGVHWRFWQWNSLAAYLFVGLAFMLGLVTVALIILAFSYRKSLSNSSSGTEAESDEKPAKQVDFEPEIVVIMAGDENRTYQNTKTPWWY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25760		ATGDU2	glutamine dumper 2 (.1)		Potri.004G108560 [exp]	0	1
AT1G43730			RNA-directed DNA polymerase (r...		Potri.016G103750 [exp]	6.00	0.7541
					Potri.013G154650 [exp]	6.78	0.5909
AT5G20710		BGAL7	beta-galactosidase 7 (.1)		Potri.018G062800 [exp]	7.34	0.7541
AT1G57775			Protein of unknown function (D...		Potri.004G109633 [exp]	10.39	0.5752
					Potri.010G154250 [exp]	14.45	0.6020
AT5G12000			Protein kinase protein with ad...		Potri.001G198300 [exp]	15.00	0.6170
AT1G02460			Pectin lyase-like superfamily ...		Potri.013G005000 [exp]	15.81	0.6634
AT4G27650		PEL1	PELOTA, Eukaryotic release fac...		Potri.004G092600 [exp]	17.54	0.6243
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Potri.007G105200 [exp]	19.49	0.6003
AT3G08690		ATUBC11, UBC11	ubiquitin-conjugating enzyme 1...		Potri.008G134400 [exp]	20.19	0.6074	Pt-UBC.3

Compare expression of checked genes

Potri.004G108560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.