Potri.004G108680 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24762 62 / 2e-13 ATGDU4 glutamine dumper 4 (.1)
AT4G31730 62 / 2e-13 ATGDU1, GDU1 glutamine dumper 1 (.1)
AT4G25760 60 / 1e-12 ATGDU2 glutamine dumper 2 (.1)
AT5G57685 60 / 2e-12 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
AT5G38770 51 / 2e-09 ATGDU7 glutamine dumper 7 (.1)
AT5G24920 50 / 7e-09 ATGDU5 glutamine dumper 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G107200 155 / 1e-50 AT5G57685 63 / 9e-14 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.017G107300 142 / 2e-45 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1)
Potri.017G107400 113 / 7e-34 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1)
Potri.004G108560 95 / 1e-26 AT4G25760 57 / 2e-11 glutamine dumper 2 (.1)
Potri.004G108440 94 / 3e-26 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1)
Potri.018G013600 66 / 2e-14 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1)
Potri.004G108800 63 / 4e-14 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1)
Potri.017G107100 62 / 5e-14 AT5G24920 48 / 2e-08 glutamine dumper 5 (.1)
Potri.006G173901 62 / 3e-13 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019985 68 / 3e-15 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019986 68 / 3e-15 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10015513 66 / 1e-14 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10006986 66 / 2e-14 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10008910 66 / 2e-14 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10026911 64 / 1e-13 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1)
Lus10020107 63 / 2e-13 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1)
Lus10006987 61 / 6e-13 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10008909 46 / 1e-07 AT5G57685 87 / 2e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence
>Potri.004G108680.1 pacid=42795070 polypeptide=Potri.004G108680.1.p locus=Potri.004G108680 ID=Potri.004G108680.1.v4.1 annot-version=v4.1
ATGAGACCTTCTACCAACTCAACAGCTGTAGGTTCTGCTCATGGGGGATTCTGGCATTGGAATTCCCCTGTAGCTTACGTCTTCGTTGGTCTAGCATTCA
TGTTGGGTCTTATCACAGTATCATTAATAATTCTTGCTTGCTCCTCTGGAAAATCTTTGTCCAACTCATCAACAAGCGAGGCTGAAGATGAAAAATCAGC
AAAACAAGTGGAAATACAGGTGGAATTTGAGCCAAATATTGTTGTGATCATGGCTGGGGATGATAATCCCACATACTTGGCCAAGCCTGTCTCTTGCAAT
TGTCCCAGTGAACAAGTTTAA
AA sequence
>Potri.004G108680.1 pacid=42795070 polypeptide=Potri.004G108680.1.p locus=Potri.004G108680 ID=Potri.004G108680.1.v4.1 annot-version=v4.1
MRPSTNSTAVGSAHGGFWHWNSPVAYVFVGLAFMLGLITVSLIILACSSGKSLSNSSTSEAEDEKSAKQVEIQVEFEPNIVVIMAGDDNPTYLAKPVSCN
CPSEQV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G24762 ATGDU4 glutamine dumper 4 (.1) Potri.004G108680 0 1
AT4G17900 PLATZ transcription factor fam... Potri.013G078500 4.24 0.8068
Potri.005G123850 11.04 0.7584
AT4G25000 AMY1, AMY3, ATA... alpha-amylase-like (.1) Potri.002G126300 15.16 0.8089
AT4G16480 ATINT4 inositol transporter 4 (.1) Potri.006G015200 29.69 0.7812
AT2G28710 C2H2ZnF C2H2-type zinc finger family p... Potri.010G209400 31.81 0.7530
AT4G19860 alpha/beta-Hydrolases superfam... Potri.015G121000 33.46 0.7702
AT2G30080 ATZIP6, ZIP6 ZIP metal ion transporter fami... Potri.001G279300 47.60 0.7775 ZIP6.3
AT2G31130 unknown protein Potri.019G089900 58.20 0.7513
AT4G21865 unknown protein Potri.010G065666 107.56 0.7502
AT3G01170 Ribosomal protein L34e superfa... Potri.017G084500 177.48 0.7461

Potri.004G108680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.