Potri.004G108800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24920 56 / 3e-11 ATGDU5 glutamine dumper 5 (.1)
AT2G24762 55 / 1e-10 ATGDU4 glutamine dumper 4 (.1)
AT4G25760 50 / 5e-09 ATGDU2 glutamine dumper 2 (.1)
AT4G31730 49 / 3e-08 ATGDU1, GDU1 glutamine dumper 1 (.1)
AT5G57685 46 / 2e-07 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
AT3G30725 43 / 3e-06 ATGDU6 glutamine dumper 6 (.1)
AT5G38770 40 / 1e-05 ATGDU7 glutamine dumper 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G107100 104 / 1e-30 AT5G24920 48 / 2e-08 glutamine dumper 5 (.1)
Potri.017G107400 56 / 3e-11 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1)
Potri.017G107300 53 / 3e-10 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1)
Potri.006G267900 53 / 8e-10 AT5G57685 83 / 2e-20 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.006G173901 50 / 7e-09 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.018G013600 49 / 4e-08 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1)
Potri.004G108680 46 / 1e-07 AT2G24762 63 / 1e-13 glutamine dumper 4 (.1)
Potri.004G108440 40 / 3e-05 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1)
Potri.017G107200 39 / 4e-05 AT5G57685 63 / 9e-14 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006987 52 / 1e-09 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10026911 49 / 4e-08 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1)
Lus10008910 49 / 5e-08 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10006986 49 / 5e-08 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10020107 46 / 3e-07 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1)
Lus10019985 39 / 0.0001 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019986 39 / 0.0001 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10015513 38 / 0.0004 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence
>Potri.004G108800.2 pacid=42795615 polypeptide=Potri.004G108800.2.p locus=Potri.004G108800 ID=Potri.004G108800.2.v4.1 annot-version=v4.1
ATGAGGGCTTCAAATGATCCTACATCAACCATAAATCTATGGCGTTCTCCAATACCTTACCTCTTTGGCAGCTTAGGCATATTGTTATCAATCATTGTTG
TAGCATTGATAACTTTAGCATGTTCTTACTACAGAAAACACTCGAGGAATTCTTCAAGTGATGAACAAGAAAAGCCGGCCGCAATACCTATAAGGATGCC
GGTTCTTGATGCAGAGCCAAAGATTGTTGTCATCATGGCCGGAGAGAACAAGCCAGCATATCTAGCAACACCAATCAATTCTTCAGCCATGAATTGTAAC
CAGCTGGGATAG
AA sequence
>Potri.004G108800.2 pacid=42795615 polypeptide=Potri.004G108800.2.p locus=Potri.004G108800 ID=Potri.004G108800.2.v4.1 annot-version=v4.1
MRASNDPTSTINLWRSPIPYLFGSLGILLSIIVVALITLACSYYRKHSRNSSSDEQEKPAAIPIRMPVLDAEPKIVVIMAGENKPAYLATPINSSAMNCN
QLG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G24920 ATGDU5 glutamine dumper 5 (.1) Potri.004G108800 0 1
Potri.015G135100 113.04 0.7446
AT5G20100 unknown protein Potri.018G029600 187.20 0.7228

Potri.004G108800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.