Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24550 74 / 6e-17 BGLU32 beta glucosidase 32 (.1) AT3G60140 72 / 1e-16 BGLU30, SRG2, DIN2 SENESCENCE-RELATED GENE 2, DARK INDUCIBLE 2, BETA GLUCOSIDASE 30, Glycosyl hydrolase superfamily protein (.1) AT5G24540 72 / 2e-16 BGLU31 beta glucosidase 31 (.1) AT2G44470 71 / 4e-16 BGLU29 beta glucosidase 29 (.1.2.3) AT2G44490 71 / 6e-16 BGLU26, PEN2 PENETRATION 2, BETA GLUCOSIDASE 26, Glycosyl hydrolase superfamily protein (.1) AT2G44460 69 / 2e-15 BGLU28 beta glucosidase 28 (.1) AT3G60120 67 / 9e-15 BGLU27 beta glucosidase 27 (.1) AT3G18070 66 / 2e-14 BGLU43 beta glucosidase 43 (.1.2) AT1G26560 66 / 3e-14 BGLU40 beta glucosidase 40 (.1) AT5G54570 64 / 1e-13 BGLU41 beta glucosidase 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G109699 [exp] 163 / 2e-51 AT5G44640 288 / 5e-94 beta glucosidase 13 (.1) Potri.004G109166 [exp] 163 / 6e-50 AT5G42260 525 / 0.0 beta glucosidase 12 (.1) Potri.001G222704 [exp] 161 / 3e-49 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2) Potri.001G222904 [exp] 161 / 3e-49 AT2G44480 531 / 0.0 beta glucosidase 17 (.1.2) Potri.001G223300 [exp] 161 / 3e-49 AT2G44480 529 / 0.0 beta glucosidase 17 (.1.2) Potri.001G222900 [exp] 161 / 3e-49 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2) Potri.004G110620 [exp] 161 / 6e-49 AT5G42260 525 / 0.0 beta glucosidase 12 (.1) Potri.004G110691 [exp] 160 / 2e-48 AT2G44480 524 / 0.0 beta glucosidase 17 (.1.2) Potri.001G223500 [exp] 80 / 3e-19 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031235 [exp] 70 / 1e-15 AT2G44450 590 / 0.0 beta glucosidase 15 (.1) Lus10031234 [exp] 70 / 1e-15 AT2G44480 563 / 0.0 beta glucosidase 17 (.1.2) Lus10037099 [exp] 64 / 8e-15 AT1G26560 149 / 6e-44 beta glucosidase 40 (.1) Lus10037988 [exp] 67 / 1e-14 AT5G54570 741 / 0.0 beta glucosidase 41 (.1) Lus10031808 [exp] 67 / 1e-14 AT2G44480 560 / 0.0 beta glucosidase 17 (.1.2) Lus10009218 [exp] 67 / 2e-14 AT5G04240 993 / 0.0 EARLY FLOWERING 6, Zinc finger (C2H2 type) family protein / transcription factor jumonji (jmj) family protein (.1) Lus10037987 [exp] 67 / 2e-14 AT5G54570 662 / 0.0 beta glucosidase 41 (.1) Lus10024065 [exp] 66 / 3e-14 AT5G44640 511 / 2e-178 beta glucosidase 13 (.1) Lus10004654 [exp] 66 / 3e-14 AT1G26560 773 / 0.0 beta glucosidase 40 (.1) Lus10036885 [exp] 66 / 4e-14 AT1G26560 778 / 0.0 beta glucosidase 40 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [poplar] [flax] Glyco_hydro_tim PF00232 [poplar] [flax] Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence Show only first row Show all	>Potri.004G110150.1 pacid=42795891 polypeptide=Potri.004G110150.1.p locus=Potri.004G110150 ID=Potri.004G110150.1.v4.1 annot-version=v4.1 ATGGACAATTTCGAATGGGGAAGTGGTTATGCTGTGAGGTTCGGCCTCTACTATGTTGATTACAAAAATGATTTGAAACGATATCCTAAACAATCAGTCA AGTGGTTCAAGCAGTTTCTTAGAAGAGACTCCCACAGTCCTATTCCACATACGTATCCTCTGATTACTTCTAATGAAACGTCGAAAATTGAAGATAGTTT GGTTCGGGATGCTAAAAGGCCAAGAAATGCCTGA
AA sequence Show only first row Show all	>Potri.004G110150.1 pacid=42795891 polypeptide=Potri.004G110150.1.p locus=Potri.004G110150 ID=Potri.004G110150.1.v4.1 annot-version=v4.1 MDNFEWGSGYAVRFGLYYVDYKNDLKRYPKQSVKWFKQFLRRDSHSPIPHTYPLITSNETSKIEDSLVRDAKRPRNA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Potri.004G110150 [exp]	0	1
AT5G42260		BGLU12	beta glucosidase 12 (.1)		Potri.004G110620 [exp]	1.73	0.9696
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Potri.004G109699 [exp]	2.82	0.9600
AT5G42260		BGLU12	beta glucosidase 12 (.1)		Potri.004G109166 [exp]	4.89	0.9332
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G222704 [exp]	5.91	0.9268
AT2G36780			UDP-Glycosyltransferase superf...		Potri.003G100500 [exp]	6.32	0.8578
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.004G110691 [exp]	6.70	0.8759
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G222904 [exp]	6.92	0.9156
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G222900 [exp]	7.00	0.9073
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G223300 [exp]	7.48	0.9060	PLIN-GEN.27
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.001G133000 [exp]	15.87	0.7585

Compare expression of checked genes

Potri.004G110150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.