Plant FIBer expression Database

Potri.004G111166 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.004G111166.1 pacid=42795803 polypeptide=Potri.004G111166.1.p locus=Potri.004G111166 ID=Potri.004G111166.1.v4.1 annot-version=v4.1
ATGTGGACTTGTCTTTCTTTTCTTGTCTCGTGCTTGTCCATGCCTTGTTGCGAATTCTTTCTCCTAAAGATCTGTGTGGATTTTCAGAGTAGAGGGTGGA
TGAGCTCTCCAAGACTTTTATGGTGGTATATCGTGTTTTGTCCATTGTACTTGTATTGTACACATAGTAGAGTAGATTCGGGGTATTTGAGGGTATTTGA
GAGTGTGGTAACAGTTATGGATGAAAGTGCTTTTCAATCAAAAATACATCAAAGTAATGTTTTTTTATTTTGTCTGTTGTACTTGTATTGTACACACAGT
AGAATAGATTCAGAGGTATTTGAAAATGTGGTAGCGATTGCGAATTAA
AA sequence
>Potri.004G111166.1 pacid=42795803 polypeptide=Potri.004G111166.1.p locus=Potri.004G111166 ID=Potri.004G111166.1.v4.1 annot-version=v4.1
MWTCLSFLVSCLSMPCCEFFLLKICVDFQSRGWMSSPRLLWWYIVFCPLYLYCTHSRVDSGYLRVFESVVTVMDESAFQSKIHQSNVFLFCLLYLYCTHS
RIDSEVFENVVAIAN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G111166
[exp]
0 1
AT3G18210 2-oxoglutarate (2OG) and Fe(II... Potri.012G051200
[exp]
7.74 0.8215
AT1G17500 ATPase E1-E2 type family prote... Potri.003G043300
[exp]
8.36 0.8157 Pt-ALA5.2
Potri.001G252604
[exp]
13.41 0.8337
AT4G05120 FUR1, ENT3, FLU... FUDR RESISTANT 1, EQUILIBRATIV... Potri.019G118400
[exp]
19.97 0.8283
AT3G07300 NagB/RpiA/CoA transferase-like... Potri.001G026100
[exp]
25.92 0.7671
Potri.017G145400
[exp]
27.12 0.8148
AT5G50120 Transducin/WD40 repeat-like su... Potri.015G070900
[exp]
27.54 0.6594
AT3G18960 B3 AP2/B3-like transcriptional fa... Potri.012G093200
[exp]
28.91 0.7447
AT2G27110 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.... Potri.012G097200
[exp]
31.84 0.7979
AT1G74150 Galactose oxidase/kelch repeat... Potri.013G008200
[exp]
31.96 0.7460

Potri.004G111166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.