Potri.004G111900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64130 152 / 5e-49 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
AT1G69510 105 / 4e-30 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
AT4G16146 67 / 7e-16 cAMP-regulated phosphoprotein 19-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G102700 191 / 1e-64 AT5G64130 159 / 1e-51 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Potri.010G167000 104 / 2e-29 AT1G69510 104 / 4e-29 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Potri.008G108201 76 / 6e-19 AT4G16146 103 / 4e-30 cAMP-regulated phosphoprotein 19-related protein (.1)
Potri.010G141300 75 / 7e-19 AT4G16146 105 / 3e-31 cAMP-regulated phosphoprotein 19-related protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009146 157 / 2e-51 AT5G64130 150 / 2e-48 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Lus10028499 148 / 1e-47 AT5G64130 143 / 2e-45 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Lus10030448 99 / 2e-27 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Lus10026615 99 / 3e-27 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Lus10036768 95 / 2e-26 AT5G64130 116 / 6e-35 cAMP-regulated phosphoprotein 19-related protein (.1.2.3)
Lus10037162 93 / 3e-23 AT1G69523 268 / 4e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10037727 67 / 5e-14 AT5G49350 136 / 1e-38 Glycine-rich protein family (.1.2)
Lus10016857 64 / 2e-13 AT5G49350 138 / 3e-40 Glycine-rich protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04667 Endosulfine cAMP-regulated phosphoprotein/endosulfine conserved region
Representative CDS sequence
>Potri.004G111900.2 pacid=42794933 polypeptide=Potri.004G111900.2.p locus=Potri.004G111900 ID=Potri.004G111900.2.v4.1 annot-version=v4.1
ATGGAGGATAACAAGCAAGATCAGGTTGACGGAAATCTTTCCGAGGATAAAAGCTCCATGCCTTCATCAAAACAAGAGGAGGAAGTTGTAAAGAAGAAAT
ACGGAGGAATTTTGCCTAAGAAACCACCTCTCATTTCTAAGGACCATGAACGTGCCTACTTTGATTCTGCTGATTGGGCACTTGGAAAGCAAGGTGTTGA
TAAGCCTAAAGGACCACTCGAAGCTCTTCGGCCTAAATTACAGCCCACACAACAGCAAACGCGATACCGGAAGTCTCCTTATGCCCCAGCAGATGGTGAA
GATGCAGGGAGTGCTTCATCTGAGGATGCAACTGCCAATGAATGA
AA sequence
>Potri.004G111900.2 pacid=42794933 polypeptide=Potri.004G111900.2.p locus=Potri.004G111900 ID=Potri.004G111900.2.v4.1 annot-version=v4.1
MEDNKQDQVDGNLSEDKSSMPSSKQEEEVVKKKYGGILPKKPPLISKDHERAYFDSADWALGKQGVDKPKGPLEALRPKLQPTQQQTRYRKSPYAPADGE
DAGSASSEDATANE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64130 cAMP-regulated phosphoprotein ... Potri.004G111900 0 1
AT3G17300 EMB2786 unknown protein Potri.010G152100 1.00 0.7699
AT1G76860 Small nuclear ribonucleoprotei... Potri.005G191600 4.47 0.7670
AT1G07020 unknown protein Potri.009G077700 5.91 0.7350 CALS1.1
AT4G17010 unknown protein Potri.012G038600 6.92 0.7299
AT3G52730 ubiquinol-cytochrome C reducta... Potri.009G149300 7.93 0.7610
AT2G46390 SDH8 succinate dehydrogenase 8, unk... Potri.014G095901 8.48 0.7380
AT1G79390 unknown protein Potri.008G081400 8.48 0.7285
AT3G57785 unknown protein Potri.006G056900 12.12 0.6874
AT4G29670 ACHT2 atypical CYS HIS rich thiored... Potri.018G066500 14.83 0.6870
AT4G39880 Ribosomal protein L23/L15e fam... Potri.005G075500 15.49 0.7397

Potri.004G111900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.