Potri.004G113600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15750 311 / 4e-110 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
AT5G39850 48 / 5e-07 Ribosomal protein S4 (.1)
AT5G15200 48 / 6e-07 Ribosomal protein S4 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G101200 363 / 1e-130 AT5G15750 291 / 6e-102 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Potri.011G094500 51 / 5e-08 AT5G39850 336 / 3e-119 Ribosomal protein S4 (.1)
Potri.016G076500 47 / 1e-06 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.016G076800 47 / 1e-06 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.007G056100 47 / 1e-06 AT5G39850 337 / 1e-119 Ribosomal protein S4 (.1)
Potri.006G209700 47 / 1e-06 AT5G39850 325 / 6e-115 Ribosomal protein S4 (.1)
Potri.018G062300 47 / 2e-06 AT5G39850 332 / 1e-117 Ribosomal protein S4 (.1)
Potri.006G209801 41 / 7e-05 AT5G15200 200 / 7e-67 Ribosomal protein S4 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001767 335 / 2e-119 AT5G15750 317 / 3e-112 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Lus10012839 50 / 1e-07 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10030487 50 / 1e-07 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10008624 50 / 2e-07 AT5G15200 342 / 8e-122 Ribosomal protein S4 (.1.2)
Lus10042193 47 / 4e-06 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0492 S4 PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
CL0492 S4 PF01479 S4 S4 domain
Representative CDS sequence
>Potri.004G113600.1 pacid=42794267 polypeptide=Potri.004G113600.1.p locus=Potri.004G113600 ID=Potri.004G113600.1.v4.1 annot-version=v4.1
ATGAGGAAGCTAAAGTTTCACGAGAGAAAGCTGCTAAAGAAAGTAAATTTCTTGGACTGGAAAAGAGAGCAGAATCACAGAGAAGCACATGTTATGCAAC
GTTACCACATCGTTGAGCGTGATGATTACAAGAAGTATTCTAGTGTGTGCCGGATGGTGCAGAAGTTGACAAATATTTTGAAGCAGATGGATCCTAGAGA
CCCTTATCGTGTTGAAATGACTGACGTTCTTTTGGAGAAGCTCTACAACATGGGTGTGATACCGAGCAGGAAAAGCTTGGCCTTGTGTGATCGCTTGTCA
GTGTCATCCTTTTGCAGGCGTAGGCTTTCAACTGTTTTGATGAGATTGAAGTTTGCTGAACACTTAAAAGAAGCCATAACATACATTGAGCAGGGGCATA
TTCGTGCAGGTCCCGAGACCGTTACTGACCCAGCATTCCTGGTAACAAGGAGCATGGAAGACTTTGTTACTTGGGTAGATACATCCAAGATAAAGAGAAA
GGTGCTTGAATATAATGAGAATCTGGATGATTATGATGCAATGAACTAG
AA sequence
>Potri.004G113600.1 pacid=42794267 polypeptide=Potri.004G113600.1.p locus=Potri.004G113600 ID=Potri.004G113600.1.v4.1 annot-version=v4.1
MRKLKFHERKLLKKVNFLDWKREQNHREAHVMQRYHIVERDDYKKYSSVCRMVQKLTNILKQMDPRDPYRVEMTDVLLEKLYNMGVIPSRKSLALCDRLS
VSSFCRRRLSTVLMRLKFAEHLKEAITYIEQGHIRAGPETVTDPAFLVTRSMEDFVTWVDTSKIKRKVLEYNENLDDYDAMN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G15750 Alpha-L RNA-binding motif/Ribo... Potri.004G113600 0 1
AT3G13882 Ribosomal protein L34 (.1.2) Potri.003G041100 2.44 0.8199
AT1G29250 Alba DNA/RNA-binding protein (... Potri.006G252000 2.82 0.8109
AT3G10950 Zinc-binding ribosomal protein... Potri.003G085100 3.31 0.8210
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.011G072400 4.89 0.8130 RPL18.5
AT1G53645 hydroxyproline-rich glycoprote... Potri.015G137000 4.89 0.7894
AT5G65860 ankyrin repeat family protein ... Potri.014G019000 5.00 0.8098
AT1G09810 ECT11 evolutionarily conserved C-ter... Potri.004G223800 7.48 0.7866
AT1G25260 Ribosomal protein L10 family p... Potri.001G460100 7.61 0.7693
AT5G46160 Ribosomal protein L14p/L23e fa... Potri.010G022800 8.48 0.7948 RPL14.1
AT2G35790 unknown protein Potri.010G219400 9.79 0.8083

Potri.004G113600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.