Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	No hit found
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G114450.1 pacid=42795879 polypeptide=Potri.004G114450.1.p locus=Potri.004G114450 ID=Potri.004G114450.1.v4.1 annot-version=v4.1 ATGAGAGGAGGGAGAAGAGGGAGAGGAGGAATAAGTGAGAAGGGAGGTGGTGGCAACGGAAGGGATGGTATTGGTGGCAACGGAAGGGATGGTATTGGTG GCAACGGAAGAGATGGTATTGGTGGCAACGGAAGGGATGGTATTGGTGGCAACGGAAGGGATGGTATTGGTGTCAACGGAAGGGATTGTAGCCCTGGAAG AGGTGGGAGAGGAGGGAGTTGCGGTAATGGTGGCAATATTGGAAGCGGAGGAAGAGGAGGGAGAACAGGTGTTTTCGGGTCTTGA
AA sequence Show only first row Show all	>Potri.004G114450.1 pacid=42795879 polypeptide=Potri.004G114450.1.p locus=Potri.004G114450 ID=Potri.004G114450.1.v4.1 annot-version=v4.1 MRGGRRGRGGISEKGGGGNGRDGIGGNGRDGIGGNGRDGIGGNGRDGIGGNGRDGIGVNGRDCSPGRGGRGGSCGNGGNIGSGGRGGRTGVFGS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.004G114450 [exp]	0	1
AT5G15780			Pollen Ole e 1 allergen and ex...		Potri.004G114300 [exp]	4.00	0.8914
AT1G60590			Pectin lyase-like superfamily ...		Potri.008G189200 [exp]	4.24	0.8457
AT2G26870		NPC2	non-specific phospholipase C2 ...		Potri.001G275500 [exp]	7.00	0.8310
					Potri.006G166850 [exp]	7.07	0.7621
AT1G34300			lectin protein kinase family p...		Potri.019G086300 [exp]	7.48	0.8200
AT1G16060	AP2_ERF	ADAP	ARIA-interacting double AP2 do...		Potri.001G041500 [exp]	10.00	0.8419
AT1G31650		ATROPGEF14, ROP...	RHO guanyl-nucleotide exchange...		Potri.003G106400 [exp]	12.32	0.7819
AT1G01120		KCS1	3-ketoacyl-CoA synthase 1 (.1)		Potri.002G178000 [exp]	12.72	0.8333	Pt-KCS1.1
AT1G43710		EMB1075	embryo defective 1075, Pyridox...		Potri.005G190500 [exp]	13.85	0.7723
AT5G12970			Calcium-dependent lipid-bindin...		Potri.003G210801 [exp]	18.43	0.8095

Compare expression of checked genes

Potri.004G114450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.