Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPS19.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1) AT3G02080 267 / 9e-94 Ribosomal protein S19e family protein (.1) AT5G15520 259 / 1e-90 Ribosomal protein S19e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G092200 [exp] 283 / 5e-100 AT5G61170 270 / 5e-95 Ribosomal protein S19e family protein (.1) Potri.015G056100 [exp] 271 / 3e-95 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020836 [exp] 261 / 4e-91 AT3G02080 258 / 5e-90 Ribosomal protein S19e family protein (.1) Lus10033532 [exp] 261 / 4e-91 AT3G02080 258 / 3e-90 Ribosomal protein S19e family protein (.1) Lus10013188 [exp] 259 / 2e-90 AT3G02080 259 / 2e-90 Ribosomal protein S19e family protein (.1) Lus10010339 [exp] 216 / 3e-73 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10000095 [exp] 216 / 3e-73 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10030702 [exp] 214 / 7e-73 AT3G02080 215 / 2e-73 Ribosomal protein S19e family protein (.1) Lus10021865 [exp] 213 / 2e-72 AT3G02080 216 / 7e-74 Ribosomal protein S19e family protein (.1) Lus10032992 [exp] 210 / 2e-71 AT3G02080 218 / 1e-74 Ribosomal protein S19e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF01090 [poplar] [flax] Ribosomal_S19e Ribosomal protein S19e
Representative CDS sequence Show only first row Show all	>Potri.004G118800.1 pacid=42795084 polypeptide=Potri.004G118800.1.p locus=Potri.004G118800 ID=Potri.004G118800.1.v4.1 annot-version=v4.1 ATGGCGACAGCTAAAACTGTGAAGGACGTTTCTCCTCATGAGTTCGTCAAGGCATACTCTGCTCACCTTAAACGATCTGGCAAGGTAGAGTTGCCTCCAT GGACTGATATTGTGAAGACTGCTAAATTTAAGGAGCTTGCGCCATATGATCCTGACTGGTACTATATTAGAGCTGCCTCCATGGCAAGGAAGATTTACTT GAGGGGAGGCCTTGGTGTGGGTGCTTTCCGTAGGATTTATGGTGGGAGCCAAAGGAATGGAAGTCGTCCACCTCATTTCTGCAAGAGCAGTGGTTCTGTT GCACGTCACATTCTTCAACAATTGCAGAACATGAACATCATCGATGTTGATCCTAAGGGTGGGAGGAGAATCACTTCAAGCGGTCAACGGGATCTTGACC AAGTTGCTGGACGCATTGTGGTGGCCCCTTGA
AA sequence Show only first row Show all	>Potri.004G118800.1 pacid=42795084 polypeptide=Potri.004G118800.1.p locus=Potri.004G118800 ID=Potri.004G118800.1.v4.1 annot-version=v4.1 MATAKTVKDVSPHEFVKAYSAHLKRSGKVELPPWTDIVKTAKFKELAPYDPDWYYIRAASMARKIYLRGGLGVGAFRRIYGGSQRNGSRPPHFCKSSGSV ARHILQQLQNMNIIDVDPKGGRRITSSGQRDLDQVAGRIVVAP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G61170			Ribosomal protein S19e family ...		Potri.004G118800 [exp]	0	1	RPS19.1
AT4G10450			Ribosomal protein L6 family (....		Potri.011G147700 [exp]	1.00	0.9744	Pt-RPL9.4
AT5G27700			Ribosomal protein S21e (.1)		Potri.005G026000 [exp]	2.00	0.9694
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Potri.004G196500 [exp]	3.46	0.9562	Pt-RPL30.1
AT4G15000			Ribosomal L27e protein family ...		Potri.016G019000 [exp]	3.46	0.9554	RPL27.1
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.002G257500 [exp]	8.00	0.9205
AT4G39200			Ribosomal protein S25 family p...		Potri.009G118900 [exp]	8.12	0.9411
AT5G48760			Ribosomal protein L13 family p...		Potri.017G054600 [exp]	8.48	0.9440	RPL13.2
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.012G024300 [exp]	9.53	0.9468	Pt-UBQ1.2
AT4G14320			Zinc-binding ribosomal protein...		Potri.007G071800 [exp]	10.67	0.9468
AT2G19740			Ribosomal protein L31e family ...		Potri.018G070100 [exp]	10.95	0.9391

Compare expression of checked genes

Potri.004G118800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.