Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69490 87 / 3e-21 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT5G17260 89 / 4e-21 NAC ANAC086 NAC domain containing protein 86 (.1) AT2G33480 85 / 2e-20 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT5G13180 84 / 3e-20 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT1G65910 86 / 4e-20 NAC ANAC028 NAC domain containing protein 28 (.1) AT1G34180 86 / 6e-20 NAC ANAC016 NAC domain containing protein 16 (.1.2) AT4G36160 84 / 1e-19 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2, NAC domain containing protein 76 (.1) AT5G46590 83 / 1e-19 NAC ANAC096 NAC domain containing protein 96 (.1) AT3G17730 82 / 2e-19 NAC ANAC057 NAC domain containing protein 57 (.1) AT3G03200 83 / 5e-19 NAC ANAC045 NAC domain containing protein 45 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G023900 [exp] 245 / 3e-84 AT5G17260 89 / 7e-21 NAC domain containing protein 86 (.1) Potri.012G024200 [exp] 245 / 4e-84 AT5G17260 97 / 5e-24 NAC domain containing protein 86 (.1) Potri.015G007000 [exp] 233 / 2e-79 AT2G33480 100 / 4e-26 NAC domain containing protein 41 (.1.2) Potri.012G024100 [exp] 227 / 2e-77 AT5G17260 90 / 2e-21 NAC domain containing protein 86 (.1) Potri.010G166200 [exp] 94 / 2e-23 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.008G089000 [exp] 91 / 1e-22 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.001G061200 [exp] 91 / 1e-22 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.009G052300 [exp] 92 / 2e-22 AT1G01720 179 / 2e-53 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G166500 [exp] 89 / 7e-22 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001809 [exp] 92 / 5e-23 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10037156 [exp] 90 / 5e-22 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10036773 [exp] 89 / 9e-22 AT1G69490 318 / 1e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10002581 [exp] 89 / 1e-21 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10003847 [exp] 88 / 5e-21 AT1G61110 196 / 3e-60 NAC domain containing protein 25 (.1) Lus10020896 [exp] 87 / 3e-20 AT5G09330 276 / 2e-88 VND-interacting 1, NAC domain containing protein 82 (.1.2.3.4) Lus10031142 [exp] 84 / 1e-19 AT1G12260 351 / 4e-120 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10031721 [exp] 84 / 2e-19 AT1G12260 353 / 4e-121 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10042284 [exp] 82 / 3e-19 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10026373 [exp] 82 / 4e-19 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.004G119400.1 pacid=42794756 polypeptide=Potri.004G119400.1.p locus=Potri.004G119400 ID=Potri.004G119400.1.v4.1 annot-version=v4.1 ATGTCTAGTGGCGTGCCTGTCGCTGCTGGCTATAAGTTTTGCCCCATGGATGATGATCTTGTTGTATATTATTTGAAGAGGAAAATTCTAGGTGAACAAC TTCCTGCTAACCTTATTCCTACCATTGATGTTTACGCATCAAGCCCAGATAAACTCCCTTTGGGTTTATTTCAATTGGGGCAGGCCAACGAGTGGTTTTT CTTTTCCACCAAGAGTAAAGACGACGACATTACGGTAATAGATGGTGGTTACTATGAGATCGATCCTGACGGTGCAGCTCCGATCACATGGGAGGGTAAA ATTGTTGGTCATGTGAAGACACTGTTTTTCTATCAAGGAAGTCCTCCTAATGGAACTGACACTGAATGGATGGTAGAGGAATTTAGAATTAATCCTGAGT TTGTTCCAGTTGACAAAGCTGACCATAACACTCAAGAGAAGATTACAAACCTTGTTGTATGCAAAATTTATCGAATGCGGCCACTACCTGAACCCTAA
AA sequence Show only first row Show all	>Potri.004G119400.1 pacid=42794756 polypeptide=Potri.004G119400.1.p locus=Potri.004G119400 ID=Potri.004G119400.1.v4.1 annot-version=v4.1 MSSGVPVAAGYKFCPMDDDLVVYYLKRKILGEQLPANLIPTIDVYASSPDKLPLGLFQLGQANEWFFFSTKSKDDDITVIDGGYYEIDPDGAAPITWEGK IVGHVKTLFFYQGSPPNGTDTEWMVEEFRINPEFVPVDKADHNTQEKITNLVVCKIYRMRPLPEP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Potri.004G119400 [exp]	0	1
AT2G34560			P-loop containing nucleoside t...		Potri.004G065100 [exp]	9.79	0.8840
AT1G50670			OTU-like cysteine protease fam...		Potri.011G139500 [exp]	19.49	0.8766
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.013G076501 [exp]	29.69	0.8349
AT3G50590			Transducin/WD40 repeat-like su...		Potri.005G136300 [exp]	34.79	0.8739
AT3G54230		SUA	suppressor of abi3-5 (.1.2)		Potri.017G138401 [exp]	36.74	0.8716
AT5G47540			Mo25 family protein (.1)		Potri.002G222800 [exp]	36.76	0.8691
					Potri.003G104800 [exp]	39.94	0.8705
AT4G16800			ATP-dependent caseinolytic (Cl...		Potri.003G080800 [exp]	40.42	0.8189
					Potri.018G015000 [exp]	43.15	0.8403
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Potri.013G042100 [exp]	43.47	0.8549

Compare expression of checked genes

Potri.004G119400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.