Potri.004G119600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39240 60 / 5e-13 unknown protein
AT3G29370 59 / 7e-13 P1R3 P1R3, unknown protein
AT4G30410 41 / 3e-05 sequence-specific DNA binding transcription factors (.1.2)
AT2G43060 37 / 0.0008 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G093000 115 / 8e-35 AT5G39240 64 / 3e-14 unknown protein
Potri.014G118300 39 / 7e-05 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Potri.002G193300 38 / 0.0003 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Potri.002G060100 37 / 0.0005 AT3G58850 80 / 4e-20 phy rapidly regulated 2 (.1)
Potri.005G201500 37 / 0.0005 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G119600.1 pacid=42795922 polypeptide=Potri.004G119600.1.p locus=Potri.004G119600 ID=Potri.004G119600.1.v4.1 annot-version=v4.1
ATGAGTTCAACTCTAAAAAAGTCCAAGGTTTCACTAGGAAGAACGGAAAGAAGAAGAAGAAGAAGACCACATGGACGTTCTTGCAGAGCTCAAAGAAGCA
TTTGCAGTGGTGGGTTCGTGACAAGCCCCAACAAGGTATCGGACAAGATGGAGGCTCTCAAGAACCTCATTCCAGCTACCCATAATGGAGAGGTAAAAGC
TGACCAGTTGTTCCAAGAAACTGCTGATTATATTGTCCTCTTGAGGACCCAAGTTCTTGTATTGAAGGGTCTGATTGACTTTTATGGATCCAGTACCGAA
AGAGACAATTAA
AA sequence
>Potri.004G119600.1 pacid=42795922 polypeptide=Potri.004G119600.1.p locus=Potri.004G119600 ID=Potri.004G119600.1.v4.1 annot-version=v4.1
MSSTLKKSKVSLGRTERRRRRRPHGRSCRAQRSICSGGFVTSPNKVSDKMEALKNLIPATHNGEVKADQLFQETADYIVLLRTQVLVLKGLIDFYGSSTE
RDN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G39240 unknown protein Potri.004G119600 0 1
AT1G65880 BZO1 benzoyloxyglucosinolate 1 (.1) Potri.017G138350 1.73 0.9975
AT5G18060 SAUR-like auxin-responsive pro... Potri.009G126300 1.73 0.9968
AT5G54010 UDP-Glycosyltransferase superf... Potri.006G179700 2.44 0.9972
Potri.009G070201 3.60 0.9904
AT2G42990 GDSL-like Lipase/Acylhydrolase... Potri.014G160200 4.89 0.9944
AT1G14430 glyoxal oxidase-related protei... Potri.001G083600 5.47 0.9951
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Potri.019G094000 6.00 0.9920
AT4G19430 unknown protein Potri.003G105900 6.32 0.9919
AT2G18360 alpha/beta-Hydrolases superfam... Potri.009G117000 6.48 0.9933
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Potri.001G109700 7.74 0.9909

Potri.004G119600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.