Potri.004G120200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02120 79 / 3e-19 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G094200 160 / 2e-51 AT3G02120 87 / 3e-23 hydroxyproline-rich glycoprotein family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032981 63 / 3e-13 AT3G02120 57 / 2e-11 hydroxyproline-rich glycoprotein family protein (.1)
Lus10015381 62 / 4e-13 AT3G02120 59 / 6e-12 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence
>Potri.004G120200.2 pacid=42794720 polypeptide=Potri.004G120200.2.p locus=Potri.004G120200 ID=Potri.004G120200.2.v4.1 annot-version=v4.1
ATGGAGAACATACTCAATTCAGTGGAGAATATGCAAGAAACGCCTTTTAAGAGTCTAATGCAATCCAAACCCACCATGTTGGATTGCATAACGCCAGCAA
AGGAAGATCAAGAGATGGATCAAGAATCTGAGAATATGCAAGAAACGCCTTTTAAGAGTCTAATGCTATCCAAACCCACCATGTTGGATTGCATAACGCC
AGCAAAGGAAGATCAAGAGATGGATCAAGAATCTGAGAACTCAGGCAATGATTTGCGCAAAAGTAGCGCCCCATATCATCTCCAAGTTCCCAAGGCATTT
AAGTTCCCTGAAAGGTATAGAAGCCCAACTGATCTTATGATCTCACCCATTACAAAAGGCCTTCTTGCAAGAAACAGAAAGGGTGGTGCTCTCTTGCCAC
CAAGTTTGAATCAGCCCAAGCAGGTGCAAGATGTAGAAGTTCAGGGCGGCGGCTTTCAAAATTGA
AA sequence
>Potri.004G120200.2 pacid=42794720 polypeptide=Potri.004G120200.2.p locus=Potri.004G120200 ID=Potri.004G120200.2.v4.1 annot-version=v4.1
MENILNSVENMQETPFKSLMQSKPTMLDCITPAKEDQEMDQESENMQETPFKSLMLSKPTMLDCITPAKEDQEMDQESENSGNDLRKSSAPYHLQVPKAF
KFPERYRSPTDLMISPITKGLLARNRKGGALLPPSLNQPKQVQDVEVQGGGFQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G02120 hydroxyproline-rich glycoprote... Potri.004G120200 0 1
AT5G38300 unknown protein Potri.004G098200 4.35 0.9443
AT5G66230 Chalcone-flavanone isomerase f... Potri.007G057800 5.74 0.9620
AT5G04320 Shugoshin C terminus (.1.2) Potri.009G006100 8.94 0.9576
AT3G17640 Leucine-rich repeat (LRR) fami... Potri.011G023500 11.40 0.9170
AT2G20590 Reticulon family protein (.1.2... Potri.007G137700 11.74 0.9536
AT3G15550 unknown protein Potri.001G175500 13.22 0.9515
AT3G20060 UBC19 ubiquitin-conjugating enzyme19... Potri.001G254500 13.56 0.9531 UBC19.2
AT3G06030 AtANP3, MAPKKK1... NPK1-related protein kinase 3 ... Potri.008G149500 14.24 0.9499
AT1G80370 CYCA2;4 Cyclin A2;4 (.1) Potri.001G177100 15.49 0.9488
AT5G15510 TPX2 (targeting protein for Xk... Potri.017G092100 18.81 0.9501

Potri.004G120200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.