Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26800 94 / 1e-24 RING/U-box superfamily protein (.1) AT4G26400 85 / 3e-20 RING/U-box superfamily protein (.1.2) AT3G13430 84 / 3e-20 RING/U-box superfamily protein (.1.2.3) AT3G19950 84 / 4e-20 RING/U-box superfamily protein (.1) AT1G14200 79 / 4e-19 RING/U-box superfamily protein (.1) AT5G56340 81 / 1e-18 ATCRT1 RING/U-box superfamily protein (.1) AT2G03000 81 / 2e-18 RING/U-box superfamily protein (.1) AT1G55530 77 / 2e-17 RING/U-box superfamily protein (.1) AT3G46620 77 / 3e-17 zinc finger (C3HC4-type RING finger) family protein (.1) AT5G59550 77 / 4e-17 zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G168300 [exp] 99 / 2e-26 AT1G26800 195 / 4e-63 RING/U-box superfamily protein (.1) Potri.008G087200 [exp] 95 / 8e-25 AT1G26800 194 / 6e-63 RING/U-box superfamily protein (.1) Potri.019G032500 [exp] 91 / 4e-22 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1) Potri.013G060500 [exp] 89 / 9e-22 AT1G55530 207 / 2e-64 RING/U-box superfamily protein (.1) Potri.003G223200 [exp] 89 / 1e-21 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1) Potri.001G001500 [exp] 88 / 3e-21 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 79 / 2e-18 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.005G062400 [exp] 77 / 7e-18 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1) Potri.007G074014 [exp] 77 / 1e-17 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002637 [exp] 94 / 3e-23 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1) Lus10020258 [exp] 94 / 8e-23 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3) Lus10012819 [exp] 90 / 1e-22 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1) Lus10036757 [exp] 87 / 9e-22 AT1G26800 127 / 1e-36 RING/U-box superfamily protein (.1) Lus10030464 [exp] 87 / 1e-21 AT1G26800 181 / 3e-57 RING/U-box superfamily protein (.1) Lus10013397 [exp] 89 / 2e-21 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1) Lus10037170 [exp] 86 / 2e-21 AT1G26800 128 / 5e-37 RING/U-box superfamily protein (.1) Lus10025612 [exp] 83 / 2e-19 AT1G60360 234 / 7e-75 RING/U-box superfamily protein (.1) Lus10028063 [exp] 80 / 3e-18 AT1G60360 224 / 9e-71 RING/U-box superfamily protein (.1) Lus10001582 [exp] 76 / 1e-17 AT2G40830 178 / 2e-55 RING-H2 finger C1A (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.004G122000.1 pacid=42796053 polypeptide=Potri.004G122000.1.p locus=Potri.004G122000 ID=Potri.004G122000.1.v4.1 annot-version=v4.1 ATGGAAACGATGTCTAGTGGTGACACAAACATGATGCAAGATTCAGATTCAAATTCGCATCAACAACCCCATATTTTGCCTGGAAACATAAGACAAATAT TCCAACATGCCATCAATGATGTTTTTGCAGTAAGAGCAGCCATTCGAAGCACAAACCAAGATGGTAATAGCAATACTACTGCGAGGCGGTTGCCAGCATC GAGGGACGCAATTGATGCCATGCCAAGAATAACAGTACAAGAAGGTGGGAATGATTGTGCAATTTGTTTAAATGAGATTGGAATCGGTTCTGAACTTAGA GAGATGCCTTGTAAACATGGGTTTCATTCGGGTTGTATTGAACAGTGGTTGAGGATTCATGGGTCTTGCCCTGTTTGTCGGTTTACGATGATGCCTGTGG AAGGAGCAGAGGTCGGGGCTAGTGGATCTGAATCTTAG
AA sequence Show only first row Show all	>Potri.004G122000.1 pacid=42796053 polypeptide=Potri.004G122000.1.p locus=Potri.004G122000 ID=Potri.004G122000.1.v4.1 annot-version=v4.1 METMSSGDTNMMQDSDSNSHQQPHILPGNIRQIFQHAINDVFAVRAAIRSTNQDGNSNTTARRLPASRDAIDAMPRITVQEGGNDCAICLNEIGIGSELR EMPCKHGFHSGCIEQWLRIHGSCPVCRFTMMPVEGAEVGASGSES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G26800			RING/U-box superfamily protein...		Potri.004G122000 [exp]	0	1
AT3G15780			unknown protein		Potri.001G192500 [exp]	5.00	0.9272
AT1G68140			Protein of unknown function (D...		Potri.001G208800 [exp]	8.30	0.8903
AT5G65520			Tetratricopeptide repeat (TPR)...		Potri.002G111300 [exp]	12.44	0.8887
AT2G16860			GCIP-interacting family protei...		Potri.004G176200 [exp]	13.74	0.8795
AT3G09250			Nuclear transport factor 2 (NT...		Potri.006G093700 [exp]	18.11	0.8527
AT4G26000		PEP	PEPPER, RNA-binding KH domain-...		Potri.018G004000 [exp]	21.23	0.8717
AT5G08535			D111/G-patch domain-containing...		Potri.008G003100 [exp]	22.24	0.8545
AT4G16330			2-oxoglutarate (2OG) and Fe(II...		Potri.011G024100 [exp]	24.00	0.8950
AT2G15270			unknown protein		Potri.001G300300 [exp]	28.74	0.8368
AT5G53330			Ubiquitin-associated/translati...		Potri.012G033300 [exp]	29.32	0.8889

Compare expression of checked genes

Potri.004G122000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.