Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01050 155 / 2e-50 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1) AT5G15460 150 / 2e-48 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2) AT1G22050 137 / 4e-43 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1) AT1G77870 128 / 1e-39 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1) AT4G24990 123 / 1e-37 ATGP4 Ubiquitin family protein (.1) AT3G26980 115 / 1e-34 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G090700 [exp] 221 / 2e-76 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.001G325900 [exp] 132 / 3e-41 AT3G26980 169 / 7e-56 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.017G068100 [exp] 123 / 2e-37 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.015G101200 [exp] 116 / 5e-35 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1) Potri.012G103100 [exp] 114 / 4e-34 AT4G24990 207 / 5e-71 Ubiquitin family protein (.1) Potri.002G091800 [exp] 113 / 2e-33 AT1G22050 124 / 5e-38 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030704 [exp] 179 / 4e-60 AT5G15460 150 / 2e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2) Lus10013190 [exp] 180 / 8e-60 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2) Lus10035184 [exp] 129 / 4e-40 AT3G26980 178 / 3e-59 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10032014 [exp] 127 / 3e-39 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10012555 [exp] 130 / 3e-36 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1) Lus10041539 [exp] 116 / 1e-34 AT3G26980 168 / 4e-55 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF13881 [poplar] [flax] Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Potri.004G124600.10 pacid=42795531 polypeptide=Potri.004G124600.10.p locus=Potri.004G124600 ID=Potri.004G124600.10.v4.1 annot-version=v4.1 ATGGCTGGGGTGCAAGATCAGTTAGAGATCAAGTTTCGATTGGCGGATGGATCGGATATTGGTCCCAAAACCTTTCCTGCTGCAACAAGTGTTGCAACCT TGAAGGAAAATATTCTTGCCCACTGGCCTAAAGAAAAGGAGAATGGTCCAAGGACATTGAAGGATGTCAAGTTAATAAGTGCAGGAAAAATACTGGAAAA CAACAGAACTGTAGGGGAATGCCAAAGCCCACTGTGTGACATCCCTGGTGGGGTTACAACCATGCATGTTGTTGTTCATCCATCTTCTGTAGAGAAAGAG AAGAAAGCGGCAAACCAACCAAGGCAAAGCAAATGCGTTTGTGTTATATTATAA
AA sequence Show only first row Show all	>Potri.004G124600.10 pacid=42795531 polypeptide=Potri.004G124600.10.p locus=Potri.004G124600 ID=Potri.004G124600.10.v4.1 annot-version=v4.1 MAGVQDQLEIKFRLADGSDIGPKTFPAATSVATLKENILAHWPKEKENGPRTLKDVKLISAGKILENNRTVGECQSPLCDIPGGVTTMHVVVHPSSVEKE KKAANQPRQSKCVCVIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G01050		MUB1	membrane-anchored ubiquitin-fo...		Potri.004G124600 [exp]	0	1
AT5G13860		ELC-LIKE, ATELC...	ELCH-like (.1)		Potri.001G034200 [exp]	1.00	0.8532
AT3G53120		VPS37-1	Modifier of rudimentary (Mod(r...		Potri.016G097000 [exp]	3.74	0.8171
					Potri.013G070900 [exp]	6.92	0.7864
AT2G46620			P-loop containing nucleoside t...		Potri.002G175600 [exp]	13.71	0.8329
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Potri.005G232900 [exp]	13.92	0.7643	XBCP3.1
AT2G36300			Integral membrane Yip1 family ...		Potri.009G152600 [exp]	16.55	0.7540
AT3G27320			alpha/beta-Hydrolases superfam...		Potri.008G180500 [exp]	20.54	0.8387
AT3G01360			Family of unknown function (DU...		Potri.005G122800 [exp]	20.78	0.8022
AT4G10810			unknown protein		Potri.002G173700 [exp]	26.83	0.8091
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Potri.008G191600 [exp]	29.79	0.7304

Compare expression of checked genes

Potri.004G124600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.