Potri.004G126720 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53270 174 / 4e-55 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G065800 277 / 5e-95 AT3G53270 292 / 5e-99 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Potri.004G126760 189 / 1e-62 AT3G53270 157 / 2e-48 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001478 185 / 2e-58 AT3G53270 294 / 5e-99 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Lus10008478 184 / 3e-58 AT3G53270 273 / 4e-91 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Lus10024665 56 / 4e-10 AT3G53270 87 / 3e-21 Small nuclear RNA activating complex (SNAPc), subunit SNAP43 protein
Lus10032295 46 / 3e-06 AT4G01370 572 / 0.0 MAP kinase 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09808 SNAPc_SNAP43 Small nuclear RNA activating complex (SNAPc), subunit SNAP43
Representative CDS sequence
>Potri.004G126720.1 pacid=42794150 polypeptide=Potri.004G126720.1.p locus=Potri.004G126720 ID=Potri.004G126720.1.v4.1 annot-version=v4.1
ATGGCTTTCCAGGAAGTTTACCTACATCTTGAAGCTAGGTCTCCTACCAAATTGGCCTTCTTTATGCAGTCGTTGTATGCTCATACAATTGGTCACATGA
TTAGCACTTATTCTTTATCACAAAGGCTAGGAGGCATGTACTGCCTTTACTGTCTTTATGAGACTCAACCATTCAAGCCTCCTTTCAAAATGTACTTCTC
TCTTGGAGAGTTGAAGAAACTCAAGACCCTTGTTATAAATGCAAAAGAACATGGAATAAAAGGAGTACCTGCTTTGGTCAAAAGGATGCTAGAAAAGAAC
ATGTTTCTTTTTGGGTTTGTGGATTTACATGAAGGTTCTGTCAGTGAGACAGTGAACCAACTCACAGAATTGCAAGATGCCCGTGTGCAAGTTGCATATA
AGAAGTTATTTGATGATATTCGGATTGAGCAATTCCTCCATATGGACATGGTGGGTATGTAA
AA sequence
>Potri.004G126720.1 pacid=42794150 polypeptide=Potri.004G126720.1.p locus=Potri.004G126720 ID=Potri.004G126720.1.v4.1 annot-version=v4.1
MAFQEVYLHLEARSPTKLAFFMQSLYAHTIGHMISTYSLSQRLGGMYCLYCLYETQPFKPPFKMYFSLGELKKLKTLVINAKEHGIKGVPALVKRMLEKN
MFLFGFVDLHEGSVSETVNQLTELQDARVQVAYKKLFDDIRIEQFLHMDMVGM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G53270 Small nuclear RNA activating c... Potri.004G126720 0 1
AT5G17910 unknown protein Potri.019G044500 6.00 0.8539
AT3G22520 unknown protein Potri.010G086700 7.74 0.8132
AT3G19610 Plant protein of unknown funct... Potri.001G294600 11.61 0.8070
Potri.005G256201 12.40 0.7938
AT3G12590 unknown protein Potri.010G207900 13.41 0.7847
AT4G10320 tRNA synthetase class I (I, L,... Potri.007G126501 16.12 0.8266
AT2G34750 RNA polymerase I specific tran... Potri.007G065101 18.46 0.7845
AT5G16750 TOZ TORMOZEMBRYO DEFECTIVE, Transd... Potri.019G047300 19.07 0.8079
Potri.010G026350 21.02 0.8051
Potri.010G242200 21.44 0.7989

Potri.004G126720 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.