Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44810 86 / 7e-22 DAD1 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) AT1G06800 54 / 3e-10 PLA-I{gamma}1 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) AT2G30550 52 / 1e-09 alpha/beta-Hydrolases superfamily protein (.1.2) AT4G16820 50 / 8e-09 PLA-I{beta]2 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) AT2G31690 49 / 2e-08 alpha/beta-Hydrolases superfamily protein (.1) AT1G05800 46 / 2e-07 DGL DONGLE, alpha/beta-Hydrolases superfamily protein (.1) AT1G06250 45 / 2e-07 alpha/beta-Hydrolases superfamily protein (.1) AT2G31100 45 / 2e-07 alpha/beta-Hydrolases superfamily protein (.1) AT1G51440 45 / 4e-07 alpha/beta-Hydrolases superfamily protein (.1) AT2G42690 44 / 9e-07 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G047700 [exp] 107 / 3e-29 AT2G44810 491 / 9e-174 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.014G047900 [exp] 72 / 2e-16 AT2G44810 557 / 0.0 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.002G137900 [exp] 66 / 2e-14 AT2G44810 543 / 0.0 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.005G218500 [exp] 59 / 6e-12 AT1G06800 652 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.003G081500 [exp] 58 / 1e-11 AT4G16820 558 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Potri.002G044700 [exp] 58 / 1e-11 AT1G06800 662 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.001G153100 [exp] 56 / 4e-11 AT4G16820 575 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Potri.009G051900 [exp] 54 / 3e-10 AT1G51440 700 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.002G231600 [exp] 49 / 2e-08 AT1G05800 524 / 0.0 DONGLE, alpha/beta-Hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042914 [exp] 61 / 7e-13 AT2G44810 464 / 1e-163 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Lus10040158 [exp] 61 / 7e-13 AT4G16820 573 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10004364 [exp] 61 / 8e-13 AT4G16820 587 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10000600 [exp] 60 / 1e-12 AT4G16820 304 / 4e-101 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10010997 [exp] 61 / 2e-12 AT4G16820 551 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10041165 [exp] 52 / 1e-09 AT2G44810 464 / 4e-164 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Lus10015521 [exp] 50 / 6e-09 AT1G30370 524 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10038526 [exp] 49 / 2e-08 AT1G30370 539 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10038524 [exp] 48 / 4e-08 AT1G30370 526 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10013932 [exp] 46 / 2e-07 AT4G18550 427 / 5e-149 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF01764 [poplar] [flax] Lipase_3 Lipase (class 3)
Representative CDS sequence Show only first row Show all	>Potri.004G128800.1 pacid=42795107 polypeptide=Potri.004G128800.1.p locus=Potri.004G128800 ID=Potri.004G128800.1.v4.1 annot-version=v4.1 ATGGAAATGTACGGTGATGAGCCACTCAGCTTCACAATCACGGGTCACAGCCTCGCTCTCGCTACCTTGACTGCATATGATATAAACTCTACCTTTAAAA ATGCACCAATTGTGACAGTAATGTCCTTCGGTGGGCCACGTGTAGGGAATAGAAGCTTTAGCTGGAGAAAAGTGGGACCAGGATATTACGTATAG
AA sequence Show only first row Show all	>Potri.004G128800.1 pacid=42795107 polypeptide=Potri.004G128800.1.p locus=Potri.004G128800 ID=Potri.004G128800.1.v4.1 annot-version=v4.1 MEMYGDEPLSFTITGHSLALATLTAYDINSTFKNAPIVTVMSFGGPRVGNRSFSWRKVGPGYYV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Potri.004G128800 [exp]	0	1
AT5G23260	MADS	ABS, TT16, AGL3...	TRANSPARENT TESTA16, AGAMOUS-l...		Potri.012G125600 [exp]	4.69	0.5804
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Potri.003G194100 [exp]	6.92	0.4962	ATCHX1.2
AT5G39280		ATEXP23, ATHEXP...	EXPANSIN 23, expansin A23 (.1)		Potri.017G092700 [exp]	18.33	0.4855	ATEXPA21.1,PtEXPA27
AT1G57775			Protein of unknown function (D...		Potri.004G114901 [exp]	24.81	0.4191
					Potri.002G209988 [exp]	48.51	0.3848
AT2G33480	NAC	ANAC041	NAC domain containing protein ...		Potri.017G031000 [exp]	52.33	0.3715	NAC131
AT5G23280	TCP	TCP7	TCP family transcription facto...		Potri.009G009400 [exp]	62.96	0.3487
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Potri.012G133800 [exp]	67.23	0.3889	Pt-ARR13.1,PtRR17
AT5G06820		SRF2	STRUBBELIG-receptor family 2 (...		Potri.006G190700 [exp]	101.92	0.3557
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.002G038100 [exp]	133.59	0.3014	Pt-GY4.1

Compare expression of checked genes

Potri.004G128800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.