Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34450 132 / 6e-40 HMG-box (high mobility group) DNA-binding family protein (.1), HMG-box (high mobility group) DNA-binding family protein (.2) AT3G51880 77 / 2e-18 AtHMGB1, NFD1, HMGB1 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) AT2G17560 72 / 2e-16 NFD4, NFD04, HMGB4 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D4, high mobility group B4 (.1.2.3) AT1G20693 69 / 2e-15 HMGBETA1, NFD2, NFD02, HMGB2 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) AT4G35570 68 / 3e-15 NFD5, NFD05, HMGD, HMGB5 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR 5, high mobility group B5 (.1) AT1G20696 67 / 1e-14 NFD3, NFD03, HMGB3 high mobility group B3 (.1.2.3) AT5G23420 54 / 3e-09 HMGB6 high-mobility group box 6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G000900 [exp] 71 / 9e-16 AT5G23420 156 / 8e-48 high-mobility group box 6 (.1.2) Potri.005G101400 [exp] 70 / 1e-15 AT1G20696 112 / 2e-32 high mobility group B3 (.1.2.3) Potri.010G189900 [exp] 67 / 4e-14 AT3G51880 129 / 3e-38 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Potri.008G067400 [exp] 66 / 7e-14 AT3G51880 100 / 4e-27 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Potri.002G009000 [exp] 60 / 1e-11 AT1G20696 146 / 8e-46 high mobility group B3 (.1.2.3) Potri.005G252600 [exp] 57 / 1e-10 AT1G20696 147 / 7e-46 high mobility group B3 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025391 [exp] 130 / 1e-38 AT2G34450 137 / 8e-42 HMG-box (high mobility group) DNA-binding family protein (.1), HMG-box (high mobility group) DNA-binding family protein (.2) Lus10015268 [exp] 120 / 8e-32 AT2G13620 507 / 1e-166 CATION/H+ EXCHANGER 15, cation/hydrogen exchanger 15 (.1) Lus10040192 [exp] 69 / 6e-15 AT3G51880 140 / 1e-42 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Lus10028298 [exp] 69 / 1e-14 AT3G51880 134 / 6e-40 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Lus10012252 [exp] 66 / 2e-14 AT1G20693 164 / 1e-53 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) Lus10016025 [exp] 67 / 3e-14 AT1G20693 192 / 7e-64 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) Lus10041009 [exp] 67 / 8e-14 AT5G23420 178 / 1e-55 high-mobility group box 6 (.1.2) Lus10035511 [exp] 67 / 8e-14 AT3G51880 152 / 2e-46 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR D1, high mobility group B1 (.1.2.3.4) Lus10030738 [exp] 65 / 3e-13 AT1G20693 185 / 7e-61 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, HIGH MOBILITY GROUP BETA 1, high mobility group B2 (.1.2.3) Lus10012250 [exp] 64 / 2e-12 AT1G20696 189 / 3e-59 high mobility group B3 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [poplar] [flax] HMG-box PF00505 [poplar] [flax] HMG_box HMG (high mobility group) box
Representative CDS sequence Show only first row Show all	>Potri.004G131400.1 pacid=42796454 polypeptide=Potri.004G131400.1.p locus=Potri.004G131400 ID=Potri.004G131400.1.v4.1 annot-version=v4.1 ATGGCAAAGAAAGCTTCAAAATCCAAGAAATGTCGCTCTTCTTCTTCCTCTTCCTTAGCTTCCTCGACCTCTTCTAAAAGAGTCTCTAAAGAGGGAAAAA TGGTGTTGAGGATAAGGTCCAATGAGATCACAAAGAGGTCTACACGGCAACAGAGAGTGGTTAGGAGTGAGAATGAGAGGAGACCAAAGTCGAAGACCAA GAAAAATAAGAAATTTGATGCTAAAAAGCCCAAGAAACCTCCAACTGCTTTCTTTTACTTCTTAGAGGATTTCCGCAAGGAATTCCAAGAGCAGAATCCA GATGTCAAGTCAATGCGTGAGGTTGGCAAGGCATGTGGAGAAAAGTGGAAAACAATGACCTATGAGGAAAAGGTTAAATATTATGATATAGCCACAGAAA AGAGGGCGGAGTTTGATAGAGCCACGTCAGAATATATCAAGAGAAAGGAAAGCGGTGAAGATGAAGACCCTGAGGATGCCTCTGAGTTTGACGAGTAG
AA sequence Show only first row Show all	>Potri.004G131400.1 pacid=42796454 polypeptide=Potri.004G131400.1.p locus=Potri.004G131400 ID=Potri.004G131400.1.v4.1 annot-version=v4.1 MAKKASKSKKCRSSSSSSLASSTSSKRVSKEGKMVLRIRSNEITKRSTRQQRVVRSENERRPKSKTKKNKKFDAKKPKKPPTAFFYFLEDFRKEFQEQNP DVKSMREVGKACGEKWKTMTYEEKVKYYDIATEKRAEFDRATSEYIKRKESGEDEDPEDASEFDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34450			HMG-box (high mobility group) ...		Potri.004G131400 [exp]	0	1
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Potri.013G064400 [exp]	6.00	0.6647	UBC1.1
AT5G37480			unknown protein		Potri.013G065200 [exp]	7.34	0.6198
AT4G10100		CNX7, SIR5	"co-factor for nitrate, reduct...		Potri.019G070801 [exp]	10.24	0.6550
AT3G12760			unknown protein		Potri.008G083800 [exp]	15.87	0.5753
AT1G21760		ATFBP7	F-box protein 7 (.1)		Potri.005G178600 [exp]	16.61	0.6381
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Potri.009G165700 [exp]	17.02	0.6102
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Potri.001G135800 [exp]	19.36	0.5924
AT1G50740			Transmembrane proteins 14C (.1...		Potri.011G138100 [exp]	23.91	0.5269
AT1G11020			RING/FYVE/PHD zinc finger supe...		Potri.018G073400 [exp]	26.38	0.5589
AT1G79260			unknown protein		Potri.010G175600 [exp]	28.93	0.6108

Compare expression of checked genes

Potri.004G131400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.