Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPS14.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52580 235 / 7e-81 Ribosomal protein S11 family protein (.1) AT3G11510 234 / 2e-80 Ribosomal protein S11 family protein (.1) AT2G36160 231 / 3e-79 Ribosomal protein S11 family protein (.1) ATCG00750 56 / 2e-10 ATCG00750.1, RPS11 ribosomal protein S11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G080500 [exp] 249 / 2e-86 AT3G52580 238 / 4e-82 Ribosomal protein S11 family protein (.1) Potri.009G019400 [exp] 249 / 2e-86 AT3G52580 241 / 4e-83 Ribosomal protein S11 family protein (.1) Potri.001G218700 [exp] 246 / 2e-85 AT3G52580 241 / 4e-83 Ribosomal protein S11 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022693 [exp] 229 / 5e-77 AT3G11510 261 / 2e-89 Ribosomal protein S11 family protein (.1) Lus10021315 [exp] 232 / 4e-75 AT3G52570 397 / 2e-136 alpha/beta-Hydrolases superfamily protein (.1) Lus10016992 [exp] 230 / 3e-74 AT3G52570 433 / 1e-150 alpha/beta-Hydrolases superfamily protein (.1) Lus10014220 [exp] 206 / 2e-66 AT3G11510 236 / 4e-78 Ribosomal protein S11 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0267 [poplar] [flax] S11_L18p PF00411 [poplar] [flax] Ribosomal_S11 Ribosomal protein S11
Representative CDS sequence Show only first row Show all	>Potri.004G131800.2 pacid=42795374 polypeptide=Potri.004G131800.2.p locus=Potri.004G131800 ID=Potri.004G131800.2.v4.1 annot-version=v4.1 ATGTCATCAAGGAGAAAGACTAGAGAGCCAAAGGAAGAAAATGTGACCCTTGGACCCACTGTGAGGGAAGGGGAGCATGCTTTTGGAGTTGCTCACATCT TTGCATCATTTAACGATACATTCATTCATGTGACTGATCTCTCTGGAAGAGAAACCCTTGTACGCATAACTGGTGGAATGAAAGTGAAAGCTGACAGAGA TGAGTCTTCACCATATGCAGCCATGCTTGCTGCCCAGGATGTGTCACAGAGATGCAAGGAACTTGGCATTACTGCCCTTCATATTAAGCTTCGTGCTACT GGTGGGAACAAGACAAAGACACCTGGTCCAGGTGCACAGTCTGCCCTTCGTGCCCTTTCTCGTTCTGGAATGAGAATTGGTCGCATAGAGGATGTGACTC CAATTCCAACGGATAGCACTCGTAGAAAGGGTGGTAGAAGAGGGAGAAGGCTTTAA
AA sequence Show only first row Show all	>Potri.004G131800.2 pacid=42795374 polypeptide=Potri.004G131800.2.p locus=Potri.004G131800 ID=Potri.004G131800.2.v4.1 annot-version=v4.1 MSSRRKTREPKEENVTLGPTVREGEHAFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGITALHIKLRAT GGNKTKTPGPGAQSALRALSRSGMRIGRIEDVTPIPTDSTRRKGGRRGRRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52580			Ribosomal protein S11 family p...		Potri.004G131800 [exp]	0	1	Pt-RPS14.4
AT3G60770			Ribosomal protein S13/S15 (.1)		Potri.002G146800 [exp]	1.41	0.9779	RPS13.3
					Potri.008G070950 [exp]	2.00	0.9691
AT3G02560			Ribosomal protein S7e family p...		Potri.017G115400 [exp]	4.24	0.9773
AT4G18100			Ribosomal protein L32e (.1)		Potri.001G353900 [exp]	4.47	0.9682	Pt-RPL32.2
AT1G67430			Ribosomal protein L22p/L17e fa...		Potri.015G094400 [exp]	7.34	0.9692	RPL17.2
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.006G131500 [exp]	7.74	0.9672
AT4G25740			RNA binding Plectin/S10 domain...		Potri.004G073500 [exp]	8.77	0.9649
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.016G077200 [exp]	8.94	0.9645	UBQ1.3
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.015G141900 [exp]	9.89	0.9590
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Potri.019G131900 [exp]	10.81	0.9452	Pt-RPL10.4

Compare expression of checked genes

Potri.004G131800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.