Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30280 92 / 4e-23 Chaperone DnaJ-domain superfamily protein (.1) AT1G21660 91 / 1e-22 Chaperone DnaJ-domain superfamily protein (.1) AT4G12780 91 / 1e-22 Chaperone DnaJ-domain superfamily protein (.1.2) AT4G12770 91 / 1e-22 Chaperone DnaJ-domain superfamily protein (.1.2) AT4G36520 89 / 6e-22 Chaperone DnaJ-domain superfamily protein (.1) AT1G75310 82 / 1e-19 AUL1 auxilin-like 1, auxin-like 1 protein (.1) AT1G75100 81 / 2e-19 JAC1 J-domain protein required for chloroplast accumulation response 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G081500 [exp] 128 / 2e-36 AT1G30280 228 / 2e-69 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G120700 [exp] 97 / 9e-25 AT4G36520 299 / 1e-82 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G022600 [exp] 91 / 7e-23 AT4G36520 306 / 7e-85 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G229300 [exp] 91 / 2e-22 AT4G36520 248 / 1e-66 Chaperone DnaJ-domain superfamily protein (.1) Potri.014G042600 [exp] 90 / 3e-22 AT1G75100 261 / 2e-77 J-domain protein required for chloroplast accumulation response 1 (.1) Potri.014G197600 [exp] 89 / 4e-22 AT4G12780 329 / 1e-97 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.002G217200 [exp] 88 / 8e-22 AT4G12780 319 / 2e-94 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.002G079200 [exp] 88 / 1e-21 AT1G21660 351 / 2e-115 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G033800 [exp] 88 / 1e-21 AT4G36520 241 / 4e-64 Chaperone DnaJ-domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036149 [exp] 108 / 5e-29 AT1G30280 182 / 3e-52 Chaperone DnaJ-domain superfamily protein (.1) Lus10012303 [exp] 91 / 2e-22 AT4G12770 618 / 0.0 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10016079 [exp] 91 / 2e-22 AT4G12770 664 / 0.0 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10018811 [exp] 89 / 5e-22 AT1G75100 183 / 3e-50 J-domain protein required for chloroplast accumulation response 1 (.1) Lus10024270 [exp] 87 / 3e-21 AT1G75310 290 / 2e-80 auxilin-like 1, auxin-like 1 protein (.1) Lus10041769 [exp] 87 / 4e-21 AT1G75310 328 / 3e-92 auxilin-like 1, auxin-like 1 protein (.1) Lus10007394 [exp] 86 / 5e-21 AT4G36520 284 / 2e-78 Chaperone DnaJ-domain superfamily protein (.1) Lus10028548 [exp] 85 / 1e-20 AT1G21660 402 / 1e-133 Chaperone DnaJ-domain superfamily protein (.1) Lus10012302 [exp] 84 / 4e-20 AT4G12750 911 / 0.0 Homeodomain-like transcriptional regulator (.1) Lus10018854 [exp] 83 / 6e-20 AT1G21660 402 / 5e-134 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G133100.2 pacid=42795140 polypeptide=Potri.004G133100.2.p locus=Potri.004G133100 ID=Potri.004G133100.2.v4.1 annot-version=v4.1 ATGCAGATTCTGTGGCCAGACAGTGGTTGGTATGCAATCCCACTAACAAGCCTTGTCGAAAGCTCACAAGTCAAAAAAGTTCATCAGAAAGCAAGGCTAT GTCTCCACCCTGACAAGTTACAACAAAGAGGAGCTACGCTCCCACAGAAATATGTTGCAGAGAAGACCTTTTCCATCCTGCTGGATGCATGGGCTGCTTT CGTTTCCCAAGATTTTTGTTTAACTAGAGACGATTCAGGATCCTTTTTATACTCATTTGAAAACCAACAAGAGAAGCTAGCTTGCTCGATCGGCTAG
AA sequence Show only first row Show all	>Potri.004G133100.2 pacid=42795140 polypeptide=Potri.004G133100.2.p locus=Potri.004G133100 ID=Potri.004G133100.2.v4.1 annot-version=v4.1 MQILWPDSGWYAIPLTSLVESSQVKKVHQKARLCLHPDKLQQRGATLPQKYVAEKTFSILLDAWAAFVSQDFCLTRDDSGSFLYSFENQQEKLACSIG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G30280			Chaperone DnaJ-domain superfam...		Potri.004G133100 [exp]	0	1
AT3G22910			ATPase E1-E2 type family prote...		Potri.016G009101 [exp]	3.31	0.9686
					Potri.002G196500 [exp]	4.35	0.8893
					Potri.004G188950 [exp]	6.00	1.0000
AT5G42905			Polynucleotidyl transferase, r...		Potri.019G032650 [exp]	7.74	1.0000
					Potri.014G114801 [exp]	8.00	1.0000
					Potri.015G129650 [exp]	8.94	0.8891
AT5G63060			Sec14p-like phosphatidylinosit...		Potri.012G088350 [exp]	10.39	0.9526
AT5G49690			UDP-Glycosyltransferase superf...		Potri.017G042650 [exp]	12.48	0.8472
					Potri.015G072666 [exp]	13.41	0.9051
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.013G118400 [exp]	15.49	0.8608

Compare expression of checked genes

Potri.004G133100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.