Potri.004G133180 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G30260 61 / 1e-13 AGL79 unknown protein
AT3G14395 35 / 0.0006 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G081001 89 / 7e-25 AT1G30260 68 / 2e-16 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038517 66 / 1e-15 AT1G30260 61 / 1e-13 unknown protein
Lus10023289 65 / 1e-15 AT1G30260 61 / 6e-14 unknown protein
PFAM info
Representative CDS sequence
>Potri.004G133180.1 pacid=42796306 polypeptide=Potri.004G133180.1.p locus=Potri.004G133180 ID=Potri.004G133180.1.v4.1 annot-version=v4.1
ATGGCAAATTCACGCATAGCAAAGTTCATCACAGAGGCTGCACCACCACAATACATTAATGTCATTAGGCAAAGAGCATCGAAGCTGCTGGATACAATTA
GCGAAGAGGACAGAGATGTAGCTGCAAGTGATTCTTCTCCCATGTCACCAACTTCTTCCACCATTGTTACTACTAGTGCTACATATGTTGCTGCTGCTAA
TTCCACGTACTTTCCCAAAGGGATTCAGAGATCTTTTTCAACCTTTGAAAACTGA
AA sequence
>Potri.004G133180.1 pacid=42796306 polypeptide=Potri.004G133180.1.p locus=Potri.004G133180 ID=Potri.004G133180.1.v4.1 annot-version=v4.1
MANSRIAKFITEAAPPQYINVIRQRASKLLDTISEEDRDVAASDSSPMSPTSSTIVTTSATYVAAANSTYFPKGIQRSFSTFEN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G30260 AGL79 unknown protein Potri.004G133180 0 1
AT3G23360 Protein phosphatase 2C family ... Potri.010G070100 1.00 0.9580
Potri.003G088201 2.44 0.9408
Potri.001G278504 3.16 0.9352
AT1G47890 AtRLP7 receptor like protein 7 (.1) Potri.016G127000 4.47 0.9453
AT1G72680 ATCAD1 CINNAMYL ALCOHOL DEHYDROGENASE... Potri.006G024300 5.74 0.9009
Potri.006G102900 10.00 0.8931
AT1G30260 AGL79 unknown protein Potri.011G081001 13.78 0.9316
AT4G32480 Protein of unknown function (D... Potri.013G100500 14.49 0.9344
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Potri.013G018400 15.65 0.9006
AT2G41640 Glycosyltransferase family 61 ... Potri.016G057000 17.54 0.8947

Potri.004G133180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.