Potri.004G133550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G011401 58 / 2e-11 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G133550.1 pacid=42795865 polypeptide=Potri.004G133550.1.p locus=Potri.004G133550 ID=Potri.004G133550.1.v4.1 annot-version=v4.1
ATGGACCACGTCTCCCAGCTGCTGTCCCTCACCCCCACGATGCACAAACGCTTGGCATTCTCTAGCTATAAAAGCCAGAGAAAAGGTTGCGCAAAGAGAG
GAAGGAGAGAGAACAAACAAACAAATAGAAGAATAGCAGAGGAGCATAGGACAGAGAGAATCGAGGAGAGCATAAGATTGAGAACAAAACACACACAGAC
GCGAAGGAACAAACACAAGGGAGAAAACAAAACAACGAACCGAGAGAACGAAAAGAATAGAAAAACCAGGGAGAAAACCAGAGAGAGCAAAAACAAGAAA
CATGGGATAAATGGAGAAAGGCCACAAAACCAAAAATCACACAAGGCAAGACAAAAACAGAGGAGGGAGCATCGCCCAAACCAGCACCACCTCAGGTCTT
CGTCCTCCAACAACGTCTGA
AA sequence
>Potri.004G133550.1 pacid=42795865 polypeptide=Potri.004G133550.1.p locus=Potri.004G133550 ID=Potri.004G133550.1.v4.1 annot-version=v4.1
MDHVSQLLSLTPTMHKRLAFSSYKSQRKGCAKRGRRENKQTNRRIAEEHRTERIEESIRLRTKHTQTRRNKHKGENKTTNRENEKNRKTREKTRESKNKK
HGINGERPQNQKSHKARQKQRREHRPNQHHLRSSSSNNV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G133550 0 1
AT5G51600 ATMAP65-3, PLE PLEIADE, ARABIDOPSIS THALIANA ... Potri.006G269800 6.16 0.8434
AT5G47530 Auxin-responsive family protei... Potri.019G095800 6.48 0.7902
Potri.001G020080 10.29 0.8418
AT4G10270 Wound-responsive family protei... Potri.013G147900 14.66 0.8114
Potri.013G160350 18.97 0.7920
AT3G45670 Protein kinase superfamily pro... Potri.006G181000 20.04 0.7364
AT3G24255 RNA-directed DNA polymerase (r... Potri.010G000101 22.91 0.7520
AT1G50670 OTU-like cysteine protease fam... Potri.001G435500 33.67 0.7729
AT2G01350 QPT quinolinate phoshoribosyltrans... Potri.010G113500 33.82 0.7925
AT4G14480 Protein kinase superfamily pro... Potri.016G049500 34.32 0.7764

Potri.004G133550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.