Potri.004G134066 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04290 200 / 8e-67 Thioesterase superfamily protein (.1)
AT2G29590 77 / 2e-18 Thioesterase superfamily protein (.1)
AT3G61200 57 / 1e-10 Thioesterase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G134132 220 / 9e-75 AT1G04290 166 / 2e-53 Thioesterase superfamily protein (.1)
Potri.009G042100 72 / 1e-16 AT2G29590 177 / 8e-58 Thioesterase superfamily protein (.1)
Potri.002G155500 60 / 9e-12 AT3G61200 139 / 4e-42 Thioesterase superfamily protein (.1)
Potri.003G051900 52 / 4e-09 AT3G16175 125 / 2e-37 Thioesterase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019228 242 / 3e-83 AT1G04290 228 / 1e-77 Thioesterase superfamily protein (.1)
Lus10004288 241 / 7e-83 AT1G04290 226 / 5e-77 Thioesterase superfamily protein (.1)
Lus10040701 81 / 1e-19 AT2G29590 200 / 7e-67 Thioesterase superfamily protein (.1)
Lus10018205 77 / 2e-18 AT2G29590 206 / 6e-69 Thioesterase superfamily protein (.1)
Lus10018847 59 / 3e-11 AT3G61200 149 / 4e-46 Thioesterase superfamily protein (.1)
Lus10000809 57 / 5e-10 AT3G61200 135 / 3e-39 Thioesterase superfamily protein (.1)
Lus10006837 49 / 1e-07 AT3G16175 114 / 5e-33 Thioesterase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0050 HotDog PF03061 4HBT Thioesterase superfamily
Representative CDS sequence
>Potri.004G134066.1 pacid=42795791 polypeptide=Potri.004G134066.1.p locus=Potri.004G134066 ID=Potri.004G134066.1.v4.1 annot-version=v4.1
ATGGATTTGGAATCAGTGAAGAGATACTTAGAGACAGGAGGATATGAAGAAGACAAGAATGCATCAACCATTGAAAAAATGCCTCTCAGATTCTTTGAAA
GATTTATAATGCAAGGCCTTCATATTGATCTCATTGAACCTGGGCGTGTTGTTTGCTCCATGAAAGTCCCTCCTCGTCTTCTGAATGGTGGCAATTTCTT
GCACGGTGGGGCTACAGCCACGTTGGTCGACTTAGTAGGATCTGCTGCAATATTCACAGTTGGAGCTCCAGCAACTGGAGTTTCTGTAGAAATCAATGTT
TCATACTTGGATGCTGCTTTTGCTGATGAAGAAATCGAGATTGAAGCTAGGGTTCTTCGTGTGGGTAAAGCTGTTGGAGTTGTCAGTGTCGAGTTGAAGA
AGAAAAAGACTGGGAAAATTATTGCTCAAGGGCGTCATACTAAGTACCTAGCTGTCCCTAGTAAATTGTAA
AA sequence
>Potri.004G134066.1 pacid=42795791 polypeptide=Potri.004G134066.1.p locus=Potri.004G134066 ID=Potri.004G134066.1.v4.1 annot-version=v4.1
MDLESVKRYLETGGYEEDKNASTIEKMPLRFFERFIMQGLHIDLIEPGRVVCSMKVPPRLLNGGNFLHGGATATLVDLVGSAAIFTVGAPATGVSVEINV
SYLDAAFADEEIEIEARVLRVGKAVGVVSVELKKKKTGKIIAQGRHTKYLAVPSKL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G04290 Thioesterase superfamily prote... Potri.004G134066 0 1
AT4G22310 Uncharacterised protein family... Potri.011G023100 1.73 0.8594
AT3G11750 FOLB1 Dihydroneopterin aldolase (.1) Potri.016G067200 3.16 0.8417
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Potri.002G016600 4.24 0.8412 Pt-EMB1793.1
AT2G24765 ARF3, ARL1, ATA... ARF-LIKE 1, ADP-ribosylation f... Potri.018G013700 5.74 0.8163
AT3G23325 Splicing factor 3B subunit 5/R... Potri.008G168000 6.24 0.8137
AT2G05630 ATG8D Ubiquitin-like superfamily pro... Potri.002G228800 9.16 0.8433
AT1G76200 unknown protein Potri.002G012700 9.16 0.8425
AT5G48870 SAD1 SUPERSENSITIVE TO ABA AND DROU... Potri.001G277900 9.53 0.8386 Pt-SAD1.2
AT4G28088 Low temperature and salt respo... Potri.018G105100 10.39 0.8152
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.014G160900 12.72 0.7956

Potri.004G134066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.