Potri.004G134200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08480 151 / 8e-47 VQ motif-containing protein (.1.2)
AT1G28280 65 / 5e-13 VQ motif-containing protein (.1.2)
AT5G53830 58 / 2e-10 VQ motif-containing protein (.1)
AT1G80450 57 / 2e-10 VQ motif-containing protein (.1)
AT2G33780 55 / 2e-09 VQ motif-containing protein (.1)
AT3G15300 52 / 1e-08 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G399100 65 / 6e-13 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.011G118200 63 / 3e-12 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.004G044800 62 / 8e-12 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.011G053700 62 / 9e-12 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Potri.006G266700 59 / 3e-11 AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
Potri.006G266600 58 / 1e-10 AT1G80450 61 / 6e-12 VQ motif-containing protein (.1)
Potri.018G016500 47 / 1e-06 AT1G80450 67 / 6e-14 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026247 71 / 4e-15 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10042423 69 / 2e-14 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10020092 57 / 5e-10 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
Lus10015315 45 / 1e-05 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10005543 43 / 6e-05 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
Lus10041929 43 / 6e-05 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.004G134200.1 pacid=42794875 polypeptide=Potri.004G134200.1.p locus=Potri.004G134200 ID=Potri.004G134200.1.v4.1 annot-version=v4.1
ATGGAGAAGCCGCCAAGCCAGAGCACAGTCGGTGGTAAACCTATTACTACATTTGTGCAAACAGACACAAAGGCCTTTCGTGATGTCGTTCAGCGGTTAA
CAGGCTCATCAGAGGGTGATGCAGCAGAAGGAACAGCAGGAGCAGCAACAAAGATTGCAGGCATAAAGAGATCAACACCTAAACTCCATGAAAGAAGGCA
GAACCTAAGGCCCAAGCTAGAGATAGTGAAGCCCCCTCTTAACTTCAAACCTAGTACATCGCCAACAACATCGGGTAATCACAGTCTTCTTCCAAGTCCT
GCAGGAACCCCTTCGTTCATGTTCTCCCCTTCCACCATTTTATCAAAACTGTCAATCCAAGAACAGGAGAGCAGAGGAGAGTCAGCAATATCTGACTTAA
ATAACGAGGAAGAAGAGAAAGCCATTAAAGAGAGGCGATTTTACCTGCATCCATCACCACGGTCTAAACCTGGTTACACTGAACCAGAGTTGCTCGCCTT
GTTTCCTTTAACATCCCCCCAAGCAAGTGACAAACACTAA
AA sequence
>Potri.004G134200.1 pacid=42794875 polypeptide=Potri.004G134200.1.p locus=Potri.004G134200 ID=Potri.004G134200.1.v4.1 annot-version=v4.1
MEKPPSQSTVGGKPITTFVQTDTKAFRDVVQRLTGSSEGDAAEGTAGAATKIAGIKRSTPKLHERRQNLRPKLEIVKPPLNFKPSTSPTTSGNHSLLPSP
AGTPSFMFSPSTILSKLSIQEQESRGESAISDLNNEEEEKAIKERRFYLHPSPRSKPGYTEPELLALFPLTSPQASDKH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G08480 VQ motif-containing protein (.... Potri.004G134200 0 1
AT4G27870 Vacuolar iron transporter (VIT... Potri.012G004000 27.56 0.6958
AT1G27340 Galactose oxidase/kelch repeat... Potri.003G062000 127.15 0.6433
AT5G65780 ATBCAT-5 branched-chain amino acid amin... Potri.007G008000 190.23 0.6249
AT4G36850 PQ-loop repeat family protein ... Potri.007G031800 282.54 0.6096

Potri.004G134200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.