Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ICK5.2,6
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49620 91 / 7e-23 ICN6, ICK5, KRP7 KIP-RELATED PROTEIN 7, Cyclin-dependent kinase inhibitor family protein (.1) AT3G19150 74 / 2e-16 ACK1, ICK4, KRP6 ARABIDOPSIS CDK INHIBITOR 1, KIP-related protein 6 (.1.2) AT5G48820 67 / 2e-13 ICK6, KRP3 KIP-RELATED PROTEIN 3, inhibitor/interactor with cyclin-dependent kinase (.1.2) AT3G24810 59 / 8e-11 ICK3, KRP5 kip-related protein 5, Cyclin-dependent kinase inhibitor family protein (.1) AT2G32710 57 / 7e-10 ICK7, ACK2, KRP4 KIP-RELATED PROTEIN 4, INTERACTORS OF CDC2 KINASE 7, CYCLIN-DEPENDENT KINASE INHIBITOR 2, Cyclin-dependent kinase inhibitor family protein (.1.2) AT2G23430 47 / 2e-06 ICK1, KRP1 KIP-RELATED PROTEIN 1, Cyclin-dependent kinase inhibitor family protein (.1) AT3G50630 47 / 3e-06 ICK2, KRP2 KIP-related protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G103600 [exp] 307 / 2e-107 AT1G49620 92 / 6e-23 KIP-RELATED PROTEIN 7, Cyclin-dependent kinase inhibitor family protein (.1) Potri.007G042300 [exp] 72 / 2e-15 AT2G23430 / KIP-RELATED PROTEIN 1, Cyclin-dependent kinase inhibitor family protein (.1) Potri.002G242100 [exp] 70 / 1e-14 AT5G48820 177 / 6e-56 KIP-RELATED PROTEIN 3, inhibitor/interactor with cyclin-dependent kinase (.1.2) Potri.005G137500 [exp] 66 / 3e-13 AT3G19150 50 / 2e-07 ARABIDOPSIS CDK INHIBITOR 1, KIP-related protein 6 (.1.2) Potri.017G054000 [exp] 62 / 8e-12 AT5G48820 127 / 3e-36 KIP-RELATED PROTEIN 3, inhibitor/interactor with cyclin-dependent kinase (.1.2) Potri.001G314000 [exp] 60 / 8e-11 AT5G48820 131 / 2e-37 KIP-RELATED PROTEIN 3, inhibitor/interactor with cyclin-dependent kinase (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011862 [exp] 62 / 1e-11 AT5G48820 146 / 2e-43 KIP-RELATED PROTEIN 3, inhibitor/interactor with cyclin-dependent kinase (.1.2) Lus10043139 [exp] 58 / 4e-10 AT2G32710 143 / 2e-41 KIP-RELATED PROTEIN 4, INTERACTORS OF CDC2 KINASE 7, CYCLIN-DEPENDENT KINASE INHIBITOR 2, Cyclin-dependent kinase inhibitor family protein (.1.2) Lus10032611 [exp] 55 / 5e-09 AT2G32710 139 / 1e-39 KIP-RELATED PROTEIN 4, INTERACTORS OF CDC2 KINASE 7, CYCLIN-DEPENDENT KINASE INHIBITOR 2, Cyclin-dependent kinase inhibitor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02234 [poplar] [flax] CDI Cyclin-dependent kinase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.004G142100.1 pacid=42796172 polypeptide=Potri.004G142100.1.p locus=Potri.004G142100 ID=Potri.004G142100.1.v4.1 annot-version=v4.1 ATGGGAGAGAGCGCGAGAAATAGTACGCGGGTAGCAGAAACTGAGATTCCGGAATCCTCGATCACAAGTTTCTCAAAGAAAATGAATTTTGATTTCGAAG AGTTTAACTCACCTTCGTTGAATTTGAAGCTCCAACCTCATCGTTGCGCCGATATGTCGCCGCAGAAAGTGGTTCCACCGGGAAATTCTTCGAATCCCAG TGGCGTTCTAACCGGATTTTCCAGCTGCGGCGACTCTCCAGTACTTTCCTGCTGCTCCAGCAATGCACCGGTCCAGGTTGTGAAGGATAGCTTGAGGTTT CTAGATCTAGAGGCGAAGAGTCCCGAAACGGAAAGCTCAACGTGCAATGACAGGAAATTCAGCAGAGAAACCACTCCTTCAAGCGAGTTTCACGGCAGCA GTACCGATCACATGGACACACCGGCAGCTATAGAGAAGAAGGAAAGTCTTCGCCCGAGAGATTCACCGGCGGTGAAAATGCCGAGTCAGGCGGAGATCGA CGCGTTTTTCACGGGGGCAGAGAGAGAGGAGCAGAGAAGATTTGCGGAGAAGTACAACTATGATGTTGTGATGGATTTGCCAATGGAGGGTCGCTACCAG TGGATTTGCTTGAAGCCATAG
AA sequence Show only first row Show all	>Potri.004G142100.1 pacid=42796172 polypeptide=Potri.004G142100.1.p locus=Potri.004G142100 ID=Potri.004G142100.1.v4.1 annot-version=v4.1 MGESARNSTRVAETEIPESSITSFSKKMNFDFEEFNSPSLNLKLQPHRCADMSPQKVVPPGNSSNPSGVLTGFSSCGDSPVLSCCSSNAPVQVVKDSLRF LDLEAKSPETESSTCNDRKFSRETTPSSEFHGSSTDHMDTPAAIEKKESLRPRDSPAVKMPSQAEIDAFFTGAEREEQRRFAEKYNYDVVMDLPMEGRYQ WICLKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G49620		ICN6, ICK5, KRP...	KIP-RELATED PROTEIN 7, Cyclin-...		Potri.004G142100 [exp]	0	1	Pt-ICK5.2,6
AT3G24450			Heavy metal transport/detoxifi...		Potri.018G076400 [exp]	10.24	0.9263
AT5G01870			Bifunctional inhibitor/lipid-t...		Potri.016G136000 [exp]	15.68	0.9397	Pt-LTP2.2
AT3G04080		ATAPY1	apyrase 1 (.1)		Potri.019G031200 [exp]	18.65	0.9358	Pt-APY1.2
AT2G30220			GDSL-like Lipase/Acylhydrolase...		Potri.013G153000 [exp]	21.79	0.9355
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.010G096000 [exp]	23.87	0.9344
AT1G29450			SAUR-like auxin-responsive pro...		Potri.004G181500 [exp]	25.23	0.9343
AT1G69560	MYB	LOF2, ATMYB105	LATERAL ORGAN FUSION 2, myb do...		Potri.017G085200 [exp]	26.66	0.9328
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Potri.004G123200 [exp]	30.00	0.9326	Pt-EXP2.4
AT2G04570			GDSL-like Lipase/Acylhydrolase...		Potri.014G160100 [exp]	30.57	0.9325
AT1G35180			TRAM, LAG1 and CLN8 (TLC) lipi...		Potri.005G231600 [exp]	33.16	0.9270

Compare expression of checked genes

Potri.004G142100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.