Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06730 65 / 3e-13 Peroxidase superfamily protein (.1) AT5G06720 64 / 3e-13 ATPA2 peroxidase 2 (.1) AT1G49570 59 / 3e-11 Peroxidase superfamily protein (.1) AT3G49120 58 / 6e-11 PRX34, PRXCB, ATPERX34, PERX34, ATPCB PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) AT4G08780 55 / 8e-10 Peroxidase superfamily protein (.1) AT3G49110 54 / 1e-09 PRX33, PRXCA, ATPRX33, ATPCA PEROXIDASE 33, peroxidase CA (.1) AT2G18150 54 / 2e-09 Peroxidase superfamily protein (.1) AT3G32980 54 / 2e-09 Peroxidase superfamily protein (.1) AT5G19890 54 / 2e-09 Peroxidase superfamily protein (.1) AT2G18140 54 / 2e-09 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G106400 [exp] 78 / 3e-18 AT1G49570 429 / 2e-151 Peroxidase superfamily protein (.1) Potri.016G058200 [exp] 62 / 1e-12 AT5G06720 428 / 2e-151 peroxidase 2 (.1) Potri.001G011200 [exp] 62 / 2e-12 AT3G49120 381 / 2e-132 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.001G011000 [exp] 62 / 3e-12 AT3G49120 407 / 1e-142 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.005G135300 [exp] 61 / 7e-12 AT1G49570 408 / 3e-143 Peroxidase superfamily protein (.1) Potri.001G012901 [exp] 59 / 2e-11 AT5G06730 387 / 1e-134 Peroxidase superfamily protein (.1) Potri.001G011300 [exp] 59 / 2e-11 AT3G49120 410 / 8e-144 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.004G144600 [exp] 59 / 2e-11 AT1G49570 400 / 8e-140 Peroxidase superfamily protein (.1) Potri.001G013000 [exp] 59 / 2e-11 AT3G49120 407 / 2e-142 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020994 [exp] 67 / 5e-14 AT1G49570 418 / 5e-147 Peroxidase superfamily protein (.1) Lus10004163 [exp] 61 / 6e-12 AT5G06720 446 / 1e-158 peroxidase 2 (.1) Lus10009933 [exp] 60 / 2e-11 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1) Lus10009901 [exp] 58 / 7e-11 AT1G49570 384 / 5e-134 Peroxidase superfamily protein (.1) Lus10008581 [exp] 58 / 8e-11 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1) Lus10020312 [exp] 55 / 7e-10 AT1G04170 845 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1) Lus10008173 [exp] 55 / 9e-10 AT5G06730 407 / 3e-142 Peroxidase superfamily protein (.1) Lus10027989 [exp] 55 / 1e-09 AT5G06720 400 / 1e-139 peroxidase 2 (.1) Lus10028337 [exp] 54 / 3e-09 AT2G18150 354 / 7e-118 Peroxidase superfamily protein (.1) Lus10029065 [exp] 54 / 3e-09 AT5G05340 338 / 2e-115 Peroxidase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G144500.2 pacid=42794815 polypeptide=Potri.004G144500.2.p locus=Potri.004G144500 ID=Potri.004G144500.2.v4.1 annot-version=v4.1 ATGTATCAGGAACTTTTCTCATACTTCAGCGTTCCATTCCTTCGTTTCTTTTCTTTACTTCATCTAGTCACTCCTCCTCCTTCTGTTACTGGCCAGTTTG ATGATTACATCCACTATGATAAATCATGCCCTAATCCATCCTTGACTGTCAGAAATGTTGTCCAGAAGGCTTTGCATAGTGACTCCAGAATAGCCGCATC CCTCCTCCGCTTACACTTCCACGATGTTTTCGTAAATGTAATGATCCTGGATCTATTAATCCCCCCTCAGTTAGAAATTCCTTTGCACCTTAATTTGAAA GCAGTTTTCTGTAATAGTATAATGAAAGCACAAATCAGATCATAA
AA sequence Show only first row Show all	>Potri.004G144500.2 pacid=42794815 polypeptide=Potri.004G144500.2.p locus=Potri.004G144500 ID=Potri.004G144500.2.v4.1 annot-version=v4.1 MYQELFSYFSVPFLRFFSLLHLVTPPPSVTGQFDDYIHYDKSCPNPSLTVRNVVQKALHSDSRIAASLLRLHFHDVFVNVMILDLLIPPQLEIPLHLNLK AVFCNSIMKAQIRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G06720		ATPA2	peroxidase 2 (.1)		Potri.004G144500 [exp]	0	1
					Potri.017G045501 [exp]	2.82	0.9360
					Potri.007G086400 [exp]	3.16	0.9516
AT5G15180			Peroxidase superfamily protein...		Potri.007G122451 [exp]	13.07	0.9373
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Potri.002G052100 [exp]	18.00	0.9300	CPS.1
AT3G23510			Cyclopropane-fatty-acyl-phosph...		Potri.010G067600 [exp]	20.66	0.9300
AT1G27040			Major facilitator superfamily ...		Potri.002G129500 [exp]	21.09	0.9312
					Potri.005G081100 [exp]	21.42	0.9234
AT5G17540			HXXXD-type acyl-transferase fa...		Potri.001G127400 [exp]	22.36	0.9140
					Potri.019G016100 [exp]	28.42	0.9253
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Potri.010G071700 [exp]	31.46	0.9227	PtrPht1-2,PT2.9

Compare expression of checked genes

Potri.004G144500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.