Potri.004G144600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49570 400 / 6e-140 Peroxidase superfamily protein (.1)
AT5G06720 289 / 2e-96 ATPA2 peroxidase 2 (.1)
AT5G06730 287 / 3e-95 Peroxidase superfamily protein (.1)
AT5G19890 270 / 7e-89 Peroxidase superfamily protein (.1)
AT5G05340 266 / 2e-87 Peroxidase superfamily protein (.1)
AT4G36430 265 / 3e-87 Peroxidase superfamily protein (.1)
AT2G18140 264 / 2e-86 Peroxidase superfamily protein (.1)
AT2G18150 263 / 3e-86 Peroxidase superfamily protein (.1)
AT1G44970 263 / 5e-86 Peroxidase superfamily protein (.1)
AT5G66390 258 / 2e-84 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G106400 538 / 0 AT1G49570 429 / 2e-151 Peroxidase superfamily protein (.1)
Potri.005G135300 392 / 4e-137 AT1G49570 408 / 3e-143 Peroxidase superfamily protein (.1)
Potri.003G214500 295 / 8e-99 AT5G19890 422 / 4e-149 Peroxidase superfamily protein (.1)
Potri.014G143200 282 / 8e-94 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.016G058200 273 / 5e-90 AT5G06720 428 / 2e-151 peroxidase 2 (.1)
Potri.013G083600 272 / 7e-90 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.008G022700 271 / 2e-89 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1)
Potri.008G022248 270 / 3e-89 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1)
Potri.013G154400 270 / 4e-89 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020994 412 / 1e-144 AT1G49570 418 / 5e-147 Peroxidase superfamily protein (.1)
Lus10009901 375 / 2e-130 AT1G49570 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10023858 349 / 5e-120 AT1G49570 361 / 9e-125 Peroxidase superfamily protein (.1)
Lus10004163 287 / 1e-95 AT5G06720 446 / 1e-158 peroxidase 2 (.1)
Lus10026748 269 / 1e-88 AT5G19890 402 / 6e-141 Peroxidase superfamily protein (.1)
Lus10025535 271 / 6e-88 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10034207 265 / 5e-87 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10032786 264 / 8e-87 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10003573 262 / 3e-86 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Lus10030148 258 / 6e-85 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.004G144600.1 pacid=42794892 polypeptide=Potri.004G144600.1.p locus=Potri.004G144600 ID=Potri.004G144600.1.v4.1 annot-version=v4.1
ATGCTAATGGCTATCACACGCTTCTCATACTCCACCATTCTTGCTCTTCTTTACCTGTCTTTGCTTCACCTAGTCACTTCTTTCCCTTCTTCTAATGGTC
AGATTGATTACAATTACAACTATAATTACTATGATAGCTCATGCCCTCGTTTGGGAATGATTGTCAAGTATGGTGTCTGGGCTGCTTTCAAGAATGACAC
CAGAATAGCCGCATCCCTCCTTCGATTGCATTTCCACGACTGCTTTGTAAATGGCTGCGATGCTTCCGTACTTCTGGACGACACAATTAATTTCAGGGGA
GAGAAGAATGCTCTTCCCAACCGCAATTCAGCTAGAGGATATGAAGTCATTGAAAGCATCAAAGCAGATGTTGAAAAGGCTTGCCCATCAACTGTTTCAT
GTGTTGATATATTGGCTCTTGCAGCAAGAGAATCTGTCCTTCTGTCAGGAGGGCCTTATTATCCTCTTTCATTGGGCGGGCTAGATGGATTGACTGCAAG
TGAGAAGGCAGCTAATGAACAATTGCCATCACCATTTGAACCACTAGAAAACATCACTGCTAAGTTCGCATCAAAGGGTCTTGACATTAAGGATGTTGTA
GTCCTCTCAGGGGCACACACCATAGGTTTTGCTCAGTGCTTCTCCTTCAAGAGGAGGCTCTTCGACTTCAAAGGCACCGGCAAGCCTGACCCCACACTTG
ATTCTTCGGCCGTGGCAAACTTACAGGGCACGTGTCCAAATAAGGATGCATCAAACAGCAAACTTGCTCCTCTTGACTCTGCAAGCACATACCGATTTGA
CAATGCTTATTATGTGAACCTCGTGAACAGAACTGGCCTTCTTGAATCTGATCAAGCTCTCATGGGGGATTCCAAGACTGCTGCAATGGTTACTGCCTAC
AGCTCAAATTCATATCTTTTCTCAGCTGATTTCGCATCATCAATGGTAAAGATGAGCAACCTTGGGATACTTACAGGCAGCAATGGACAAATTAGAAAGA
AATGTGGGTCTGTCAATTAA
AA sequence
>Potri.004G144600.1 pacid=42794892 polypeptide=Potri.004G144600.1.p locus=Potri.004G144600 ID=Potri.004G144600.1.v4.1 annot-version=v4.1
MLMAITRFSYSTILALLYLSLLHLVTSFPSSNGQIDYNYNYNYYDSSCPRLGMIVKYGVWAAFKNDTRIAASLLRLHFHDCFVNGCDASVLLDDTINFRG
EKNALPNRNSARGYEVIESIKADVEKACPSTVSCVDILALAARESVLLSGGPYYPLSLGGLDGLTASEKAANEQLPSPFEPLENITAKFASKGLDIKDVV
VLSGAHTIGFAQCFSFKRRLFDFKGTGKPDPTLDSSAVANLQGTCPNKDASNSKLAPLDSASTYRFDNAYYVNLVNRTGLLESDQALMGDSKTAAMVTAY
SSNSYLFSADFASSMVKMSNLGILTGSNGQIRKKCGSVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G49570 Peroxidase superfamily protein... Potri.004G144600 0 1
Potri.002G068501 1.73 0.9101
AT3G46620 zinc finger (C3HC4-type RING f... Potri.006G164516 7.74 0.8516
AT5G41040 HXXXD-type acyl-transferase fa... Potri.017G068500 8.12 0.8080
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Potri.018G009000 11.95 0.8256
AT3G62270 HCO3- transporter family (.1) Potri.015G077600 13.41 0.8307
AT4G31540 ATEXO70G1 exocyst subunit exo70 family p... Potri.010G250500 19.79 0.8402
AT3G08040 ATFRD3, MAN1, F... MANGANESE ACCUMULATOR 1, FERRI... Potri.001G266900 21.90 0.8803 Pt-FRD3.2
AT5G25260 SPFH/Band 7/PHB domain-contain... Potri.006G258900 25.78 0.8119
AT5G19970 unknown protein Potri.018G071900 30.16 0.8292
AT4G37650 GRAS SGR7, SHR SHORT ROOT, SHOOT GRAVITROPISM... Potri.017G019900 34.49 0.8494

Potri.004G144600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.