Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 343 / 7e-117 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G55970 172 / 4e-50 ATJRG21 jasmonate-regulated gene 21 (.1) AT5G05600 171 / 6e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 171 / 8e-50 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 170 / 9e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 165 / 1e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 158 / 6e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 156 / 2e-44 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 155 / 5e-44 ATSRG1, SRG1 senescence-related gene 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G146100 [exp] 635 / 0 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 388 / 9e-135 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 388 / 9e-135 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107350 [exp] 210 / 2e-67 AT3G19000 144 / 7e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G023600 [exp] 171 / 6e-50 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G069300 [exp] 170 / 1e-49 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 167 / 2e-48 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101100 [exp] 165 / 2e-47 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 164 / 2e-47 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021002 [exp] 439 / 8e-155 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 355 / 1e-121 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 348 / 1e-118 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023850 [exp] 289 / 1e-97 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 231 / 5e-74 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10042155 [exp] 162 / 6e-48 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10005037 [exp] 166 / 2e-47 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10026173 [exp] 164 / 8e-47 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10006518 [exp] 163 / 1e-46 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004387 [exp] 162 / 3e-46 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.004G146000.1 pacid=42793968 polypeptide=Potri.004G146000.1.p locus=Potri.004G146000 ID=Potri.004G146000.1.v4.1 annot-version=v4.1 ATGGGAGAGGTTAATCCAGCCTTCATTCAAGACCTTGAGCACAGGCCAAAGCTTGAGATCATCAAAGCAGAAGGAATACCCTTAATTGATTTATCCATAA TTAGTTCTCCTAACACCAACTTGGATAACTCTCAAGCACTTGATGGTCTGGTTAAGGAGATAGGGAATGCATGCAAGAACTTGGGGTTCTTTCAAGTGAT CAATCATGGGGTGCCTCTTGACAAGCGACAAAAGATTGAGAATGCATCAAGACAATTTTTCGGTCAGCCATTAGAGGAGAAAAGGAAGGTTAGGAGAGAC GAGCGGAAGGTGTTGGGTTATTATGACACCGAGCATACCAAAAATGTTAGGGACTGGAAAGAAGTGTTTGATTTTGCTGTGAAGACTCCAACCATTGTAC CATCCTCGTATGAGCCTGATGACAAGGAAGTTACCGAATGGTTAAATGATCAGTGGCCCGAGTATCCTCTTGAACTAAGGGAGGCCTTGGAAGAATATGC TAAAGACGTGGAGAAACTAGCCTTCAAGTTGCTGGGGCTCGTTGCCCTGAGTCTAGGCTTACCAGAGAATAGGTTCCATGGATTCTTTGAAGACCAAACC AGCTTCATTAGACTCAATCATTATCCCCCTTGCCCTGTTCCACAACTAGCTCTTGGCGTTGGTCGACACAAGGACGGTGGAGCCTTGACCATCCTCGCTG AAGATGATGTTGGGGGACTAGAAGTCAAAAGAAAAACAGACGGGGAATGGATTCGAGTTAAGCCAACCCCGGATGCCTTTATCATCAATATTGGTGACAT TATCCAGGTTTGGAGCAATGATGCTTATGAGAGTGTGGAACATAGAGTTATGGTGAACTCTGAGAGGGAAAGGTTTTCCATTCCGTTTTTCTTCAACCCG GCACACTACACTGATGTGAAGCCCCTGGAGGAGCTGACAAACGAGCAAAACCCTGTCAGATACAAGCCATACAACTGGGGAAAGTTTTTTGTCACGAGAA AGCGCAGTAATTTCAAGAAGCTTGATGTAGAGAACATCCAAATTTATCACTTCAGGATACTAGAGTCCGAGTTAGCTGATAAGCTAGAGGGAGCACTGTC CATCAAGTAA
AA sequence Show only first row Show all	>Potri.004G146000.1 pacid=42793968 polypeptide=Potri.004G146000.1.p locus=Potri.004G146000 ID=Potri.004G146000.1.v4.1 annot-version=v4.1 MGEVNPAFIQDLEHRPKLEIIKAEGIPLIDLSIISSPNTNLDNSQALDGLVKEIGNACKNLGFFQVINHGVPLDKRQKIENASRQFFGQPLEEKRKVRRD ERKVLGYYDTEHTKNVRDWKEVFDFAVKTPTIVPSSYEPDDKEVTEWLNDQWPEYPLELREALEEYAKDVEKLAFKLLGLVALSLGLPENRFHGFFEDQT SFIRLNHYPPCPVPQLALGVGRHKDGGALTILAEDDVGGLEVKRKTDGEWIRVKPTPDAFIINIGDIIQVWSNDAYESVEHRVMVNSERERFSIPFFFNP AHYTDVKPLEELTNEQNPVRYKPYNWGKFFVTRKRSNFKKLDVENIQIYHFRILESELADKLEGALSIK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.004G146000 [exp]	0	1
AT1G09530	bHLH	PIF3, POC1, PAP...	PHOTOCURRENT 1, PHYTOCHROME-AS...		Potri.005G001800 [exp]	1.41	0.8016	Pt-PIF3.2
AT1G67940		ABCI17, AtSTAR1...	ARABIDOPSIS THALIANA NON-INTRI...		Potri.018G132000 [exp]	3.46	0.7889
AT4G21990		3-Apr, PRH-26, ...	PAPS REDUCTASE HOMOLOG 26, APS...		Potri.014G154200 [exp]	10.58	0.7720
AT3G48880			RNI-like superfamily protein (...		Potri.001G373900 [exp]	14.56	0.7885
AT4G16260			Glycosyl hydrolase superfamily...		Potri.010G143166 [exp]	15.77	0.7147
AT5G18860		NSH3	nucleoside hydrolase 3, inosin...		Potri.008G197500 [exp]	33.63	0.7095
AT3G56200			Transmembrane amino acid trans...		Potri.010G181800 [exp]	34.27	0.7481
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.004G146100 [exp]	36.05	0.7270
AT5G36930			Disease resistance protein (TI...		Potri.019G001600 [exp]	40.24	0.7566
AT2G46370		FIN219, JAR1	JASMONATE RESISTANT 1, FAR-RED...		Potri.014G095500 [exp]	43.08	0.7236

Compare expression of checked genes

Potri.004G146000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.