Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 375 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 365 / 1e-125 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G21420 185 / 3e-55 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 183 / 9e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 180 / 3e-53 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 180 / 3e-53 ATJRG21 jasmonate-regulated gene 21 (.1) AT4G10500 174 / 2e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 174 / 5e-51 ATSRG1, SRG1 senescence-related gene 1 (.1) AT1G78550 171 / 6e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 169 / 4e-49 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G146000 [exp] 684 / 0 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 418 / 1e-146 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 415 / 3e-145 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107350 [exp] 248 / 4e-82 AT3G19000 144 / 7e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G023600 [exp] 190 / 3e-57 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G069300 [exp] 176 / 1e-51 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 175 / 2e-51 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 173 / 1e-50 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101100 [exp] 173 / 2e-50 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021002 [exp] 468 / 5e-166 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 369 / 5e-127 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 363 / 1e-124 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023850 [exp] 282 / 5e-95 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 230 / 1e-73 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10026173 [exp] 176 / 2e-51 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10006518 [exp] 175 / 4e-51 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 175 / 4e-51 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 172 / 2e-50 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030995 [exp] 169 / 4e-49 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.004G146100.1 pacid=42796563 polypeptide=Potri.004G146100.1.p locus=Potri.004G146100 ID=Potri.004G146100.1.v4.1 annot-version=v4.1 ATGGGAGAGGTTGATCCAGCCTTCATTCAAGACCTTGAGCACAGGCCAAAGCTTGAGATCATCATAGCAGAAGGAATACCCTTAATTGATTTATCCATAA TTTGTTCTCGTAACACCAACTTGGATAACTGTCAAGCGCTTGATGATCTGGTTAAGGAGATAGGGAATGCATGCAAGAACTTGGGGTTCTTTCAAGTGAT CAATCATGGGGTGCCTCTTGACAAGCGACAAAAGATTGAGAATGCATCAAGACAATTTTTCGGTCAGCCATTAGAGGAGAAAAGGAAGGTTAGGAGAGAC GGGCGGAAGGTGTTGGGTTATTCTGACACCGAGCATACCAAAAATGTTAGGGACTGGAAAGAAGTGTTTGATTTTGCTGTGAAGACTCCAACCATTGTAC CATCCTCGTATGAGCCTGATGACAAGGAAGTTACCGAATGGTTTCATGATCAGTGGCCCGAGTATCCCCTTGAACTAAGGGAGGCCTTGGAAGAATATGC TAAAGACGTGGAGAAACTAGCCTTCAAGTTGCTGGGGCTCGTTGCCCTGAGTCTAGGCTTACCAGAGAATAGGTTCCATGGATTCTTTGAAGACCAAATC AGCTTCCTTAGACTCAATCATTATTCCCCTTGCCCTGTTCCACAACTAGCTCTTGGCGTTGGTCGACACAAGGACGGTGGAGCCTTGACCATCCTCGCTC AAGATGATGTTGGGGGTCTAGAAGTCAAAAGAAAAACAGACGGGGAATGGATTCGTGTTAAGCCAACCCCGGATGCCTTTATCATCAATGTTGGTGACAT TATCCAGGTTTGGAGCAATGATGCTTATGAGAGTGTGGAACATAGAGTTATGGTGAACTCTGAGAGGGAAAGGTTTTCCATTCCGTTTTTCTTCAACCCG GCACACTATACAGATGTGAAGCCCCTGGAGGAGCTGACAAATGAGCAAAACCCTGTCAGATACAAGCCATACAATTGGGGAAAGTTTTTTGTCACAAGAA AGCGCGGTAATTTCAAGAAGCTTGATGTTGAGAACATCCAAATTTATCACTTCAGGATACCAGAGTCCGAGTTAGCTGATAAGCTAGAGGGAGCACTGTC CATCAAGTAA
AA sequence Show only first row Show all	>Potri.004G146100.1 pacid=42796563 polypeptide=Potri.004G146100.1.p locus=Potri.004G146100 ID=Potri.004G146100.1.v4.1 annot-version=v4.1 MGEVDPAFIQDLEHRPKLEIIIAEGIPLIDLSIICSRNTNLDNCQALDDLVKEIGNACKNLGFFQVINHGVPLDKRQKIENASRQFFGQPLEEKRKVRRD GRKVLGYSDTEHTKNVRDWKEVFDFAVKTPTIVPSSYEPDDKEVTEWFHDQWPEYPLELREALEEYAKDVEKLAFKLLGLVALSLGLPENRFHGFFEDQI SFLRLNHYSPCPVPQLALGVGRHKDGGALTILAQDDVGGLEVKRKTDGEWIRVKPTPDAFIINVGDIIQVWSNDAYESVEHRVMVNSERERFSIPFFFNP AHYTDVKPLEELTNEQNPVRYKPYNWGKFFVTRKRGNFKKLDVENIQIYHFRIPESELADKLEGALSIK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.004G146100 [exp]	0	1
AT1G16490	MYB	ATMYB58	myb domain protein 58 (.1)		Potri.007G067600 [exp]	2.23	0.7737
AT5G42200			RING/U-box superfamily protein...		Potri.005G244500 [exp]	2.82	0.7775
AT4G37790	HD	HAT22	Homeobox-leucine zipper protei...		Potri.007G008200 [exp]	3.00	0.7839
AT1G71960		ATABCG25, ABCG2...	Arabidopsis thaliana ATP-bindi...		Potri.019G083000 [exp]	6.16	0.7977
AT1G71960		ATABCG25, ABCG2...	Arabidopsis thaliana ATP-bindi...		Potri.013G111900 [exp]	6.92	0.7699
AT3G16770	AP2_ERF	RAP2.03, ATEBP,...	RELATED TO AP2 3, ETHYLENE RES...		Potri.010G006800 [exp]	7.93	0.7494	RAP2.3,ERF34
AT2G05710		ACO3	aconitase 3 (.1)		Potri.002G229200 [exp]	15.87	0.7481
AT1G07150		MAPKKK13	mitogen-activated protein kina...		Potri.009G073200 [exp]	20.14	0.7434
AT5G51060		ATRBOHC, RHD2	ROOT HAIR DEFECTIVE 2, A. THAL...		Potri.015G109800 [exp]	23.02	0.7493	RHD2.2
AT5G18860		NSH3	nucleoside hydrolase 3, inosin...		Potri.008G197500 [exp]	25.09	0.7082

Compare expression of checked genes

Potri.004G146100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.